BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10b13r (744 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC024860-3|AAK29985.1| 345|Caenorhabditis elegans Hypothetical ... 32 0.49 U97014-1|AAB52425.1| 893|Caenorhabditis elegans Hypothetical pr... 29 4.6 >AC024860-3|AAK29985.1| 345|Caenorhabditis elegans Hypothetical protein Y71H2AR.2 protein. Length = 345 Score = 31.9 bits (69), Expect = 0.49 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +1 Query: 505 NNFSCTELTLPFILFKNNSFGCRKLSPEIFISLFNL 612 +NF C LT+ F ++ N SF C IF L++L Sbjct: 305 SNFCCISLTVLFKMYHNQSFKCFSGEHPIFFKLYHL 340 >U97014-1|AAB52425.1| 893|Caenorhabditis elegans Hypothetical protein T05E8.1 protein. Length = 893 Score = 28.7 bits (61), Expect = 4.6 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +3 Query: 84 NCVYNICVYFRI*PEFRSHPVCICVEPGHF 173 NC ++ + +I P+F S PVCI + G F Sbjct: 411 NCFCSMSLVNKIDPQFASDPVCIMMSIGSF 440 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,204,559 Number of Sequences: 27780 Number of extensions: 267166 Number of successful extensions: 495 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 486 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 495 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1756472266 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -