BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10b13r (744 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g14620.1 68417.m02250 expressed protein contains Pfam profile... 29 4.3 At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast /... 27 9.9 At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast /... 27 9.9 >At4g14620.1 68417.m02250 expressed protein contains Pfam profile PF04720: Protein of unknown function (DUF506) Length = 341 Score = 28.7 bits (61), Expect = 4.3 Identities = 13/45 (28%), Positives = 23/45 (51%) Frame = +1 Query: 397 NFQLLISCYSIITKKIANN*TKLLKNDYSIRNIDNYNNFSCTELT 531 NF+ LI C S + K + TK+++ + S++ D EL+ Sbjct: 108 NFKSLIQCGSFVEKSLLVEATKIIEKNKSVKRKDELRKIVVDELS 152 >At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 334 Score = 27.5 bits (58), Expect = 9.9 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = -3 Query: 412 LEAGSFSPDLCFLLNKILYNIVGIVRTRIFEEENNM 305 +E SFSPDL + + +N+ ++FE N+ Sbjct: 90 VERNSFSPDLKLFVGNLSFNVDSAQLAQLFESAGNV 125 >At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 342 Score = 27.5 bits (58), Expect = 9.9 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = -3 Query: 412 LEAGSFSPDLCFLLNKILYNIVGIVRTRIFEEENNM 305 +E SFSPDL + + +N+ ++FE N+ Sbjct: 90 VERNSFSPDLKLFVGNLSFNVDSAQLAQLFESAGNV 125 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,746,900 Number of Sequences: 28952 Number of extensions: 222013 Number of successful extensions: 390 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 385 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 390 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1643603136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -