BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10b13f (646 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_01_0635 - 5091381-5091562,5092800-5092866,5093079-5093960 30 1.8 05_04_0254 - 19444409-19444621,19444724-19444887,19444974-194450... 28 7.3 >11_01_0635 - 5091381-5091562,5092800-5092866,5093079-5093960 Length = 376 Score = 29.9 bits (64), Expect = 1.8 Identities = 19/55 (34%), Positives = 29/55 (52%) Frame = -2 Query: 489 SIRNIDNYNNFSCTELTLPFILFKNNSFGCRKLSPEIFISLFNLNHNFSKRKRVQ 325 +IR D++ NFS L ++F++ FGC K+S L N FS+ RV+ Sbjct: 155 NIRVNDSFLNFSSCP-ALEHLVFQSCKFGCAKISSSSAKRLSITNSYFSEISRVR 208 >05_04_0254 - 19444409-19444621,19444724-19444887,19444974-19445087, 19446086-19446395 Length = 266 Score = 27.9 bits (59), Expect = 7.3 Identities = 10/35 (28%), Positives = 23/35 (65%) Frame = +1 Query: 142 IIKQIILLPLWYLKHR**NIFV*IGLIHFCAPFSL 246 ++ ++++PL++ +H+ + FV +GL C FS+ Sbjct: 99 VLPFVLMVPLYHYQHKHPHNFVYLGLFTLCLSFSI 133 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,924,030 Number of Sequences: 37544 Number of extensions: 212696 Number of successful extensions: 322 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 321 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 322 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1596695220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -