BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10b13f (646 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC024860-3|AAK29985.1| 345|Caenorhabditis elegans Hypothetical ... 32 0.40 U43282-1|AAA83613.2| 547|Caenorhabditis elegans Hypothetical pr... 30 1.2 >AC024860-3|AAK29985.1| 345|Caenorhabditis elegans Hypothetical protein Y71H2AR.2 protein. Length = 345 Score = 31.9 bits (69), Expect = 0.40 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = -2 Query: 465 NNFSCTELTLPFILFKNNSFGCRKLSPEIFISLFNL 358 +NF C LT+ F ++ N SF C IF L++L Sbjct: 305 SNFCCISLTVLFKMYHNQSFKCFSGEHPIFFKLYHL 340 >U43282-1|AAA83613.2| 547|Caenorhabditis elegans Hypothetical protein T22E5.3 protein. Length = 547 Score = 30.3 bits (65), Expect = 1.2 Identities = 15/49 (30%), Positives = 24/49 (48%) Frame = -1 Query: 316 CFHSKTITSCINLMNIKFSIQMTEVKMAHRNVLSLFKQKYFIICALDTK 170 C HS+ C+ + ++KF I VK ++V ++ I C LD K Sbjct: 414 CIHSEVSFFCLGMCDVKFDIDPQRVKSCRKHVTNI------IACKLDEK 456 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,050,361 Number of Sequences: 27780 Number of extensions: 254958 Number of successful extensions: 491 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 485 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 491 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1423653030 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -