BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10b11f (599 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF127805-1|ABL67942.1| 461|Apis mellifera nicotinic acetylcholi... 24 1.3 EF127804-1|ABL67941.1| 461|Apis mellifera nicotinic acetylcholi... 24 1.3 EF127803-1|ABL67940.1| 461|Apis mellifera nicotinic acetylcholi... 24 1.3 EF127802-1|ABL67939.1| 461|Apis mellifera nicotinic acetylcholi... 24 1.3 EF127801-1|ABL67938.1| 461|Apis mellifera nicotinic acetylcholi... 24 1.3 EF127800-1|ABL67937.1| 461|Apis mellifera nicotinic acetylcholi... 24 1.3 AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 23 3.0 AY343324-1|AAQ21381.1| 156|Apis mellifera vacuolar H+ ATP synth... 22 5.3 DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholi... 21 7.0 DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholi... 21 7.0 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 21 7.0 >EF127805-1|ABL67942.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 6 protein. Length = 461 Score = 23.8 bits (49), Expect = 1.3 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = -3 Query: 525 LEGTYLFVVVFEDHRAVTLPAVVTVLHHR 439 L G+Y ++F +V L +V + HHR Sbjct: 256 LLGSYFNCIMFMVASSVVLTVLVLIFHHR 284 >EF127804-1|ABL67941.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 5 protein. Length = 461 Score = 23.8 bits (49), Expect = 1.3 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = -3 Query: 525 LEGTYLFVVVFEDHRAVTLPAVVTVLHHR 439 L G+Y ++F +V L +V + HHR Sbjct: 256 LLGSYFNCIMFMVASSVVLTVLVLIFHHR 284 >EF127803-1|ABL67940.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 4 protein. Length = 461 Score = 23.8 bits (49), Expect = 1.3 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = -3 Query: 525 LEGTYLFVVVFEDHRAVTLPAVVTVLHHR 439 L G+Y ++F +V L +V + HHR Sbjct: 256 LLGSYFNCIMFMVASSVVLTVLVLIFHHR 284 >EF127802-1|ABL67939.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 3 protein. Length = 461 Score = 23.8 bits (49), Expect = 1.3 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = -3 Query: 525 LEGTYLFVVVFEDHRAVTLPAVVTVLHHR 439 L G+Y ++F +V L +V + HHR Sbjct: 256 LIGSYFNCIMFMVASSVVLTVLVLIFHHR 284 >EF127801-1|ABL67938.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 2 protein. Length = 461 Score = 23.8 bits (49), Expect = 1.3 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = -3 Query: 525 LEGTYLFVVVFEDHRAVTLPAVVTVLHHR 439 L G+Y ++F +V L +V + HHR Sbjct: 256 LIGSYFNCIMFMVASSVVLTVLVLIFHHR 284 >EF127800-1|ABL67937.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 1 protein. Length = 461 Score = 23.8 bits (49), Expect = 1.3 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = -3 Query: 525 LEGTYLFVVVFEDHRAVTLPAVVTVLHHR 439 L G+Y ++F +V L +V + HHR Sbjct: 256 LIGSYFNCIMFMVASSVVLTVLVLIFHHR 284 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 22.6 bits (46), Expect = 3.0 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +2 Query: 485 WSSKTTTNK*VPSSL*ETLATAVYD 559 WSSKT TN V S+ + + YD Sbjct: 222 WSSKTETNATVLHSINKVIIHPKYD 246 >AY343324-1|AAQ21381.1| 156|Apis mellifera vacuolar H+ ATP synthase 16 kDa proteolipidsubunit protein. Length = 156 Score = 21.8 bits (44), Expect = 5.3 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -2 Query: 247 GGGWIPSGYCSPRGYVHLPA 188 GG P GY +G+VHL A Sbjct: 77 GGLEEPKGYTLFKGFVHLGA 96 >DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 21.4 bits (43), Expect = 7.0 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = -3 Query: 525 LEGTYLFVVVFEDHRAVTLPAVVTVLHHR 439 L G+Y ++F +V L +V HHR Sbjct: 324 LLGSYFNCIMFMVASSVVLTVLVLNFHHR 352 >DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 21.4 bits (43), Expect = 7.0 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = -3 Query: 525 LEGTYLFVVVFEDHRAVTLPAVVTVLHHR 439 L G+Y ++F +V L +V HHR Sbjct: 324 LIGSYFNCIMFMVASSVVLTVLVLNFHHR 352 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 21.4 bits (43), Expect = 7.0 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = -2 Query: 592 SDTVSRFYLKSIIHSSRERFLQARGDLFICRRL 494 ++ +SR + S + R F+ R L IC L Sbjct: 743 TNRISRIFNASKHSAKRPSFISPRSQLIICSGL 775 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 156,018 Number of Sequences: 438 Number of extensions: 2930 Number of successful extensions: 16 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17604432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -