BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10b10f (588 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_43857| Best HMM Match : MAP1_LC3 (HMM E-Value=0) 235 2e-62 SB_13547| Best HMM Match : MAP1_LC3 (HMM E-Value=0) 95 5e-20 SB_52412| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_55930| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_13733| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_40533| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.9 SB_42248| Best HMM Match : Keratin_B2 (HMM E-Value=4.4) 28 6.5 SB_56499| Best HMM Match : MFS_1 (HMM E-Value=0.29) 27 8.6 SB_55747| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_47703| Best HMM Match : GIY-YIG (HMM E-Value=0.56) 27 8.6 SB_46172| Best HMM Match : Peptidase_C54 (HMM E-Value=1) 27 8.6 SB_397| Best HMM Match : MFS_1 (HMM E-Value=0.16) 27 8.6 SB_47833| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_39196| Best HMM Match : Phage_GP20 (HMM E-Value=3.9) 27 8.6 SB_29369| Best HMM Match : GIY-YIG (HMM E-Value=0.56) 27 8.6 SB_413| Best HMM Match : Phage_GP20 (HMM E-Value=3.9) 27 8.6 >SB_43857| Best HMM Match : MAP1_LC3 (HMM E-Value=0) Length = 119 Score = 235 bits (575), Expect = 2e-62 Identities = 106/116 (91%), Positives = 114/116 (98%) Frame = +3 Query: 63 MKFQYKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQF 242 MK++YKEEH FEKR+AEGEKIR+KYPDRVPVIVEKAPKAR+GDLDKKKYLVPSDLTVGQF Sbjct: 1 MKWEYKEEHPFEKRRAEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQF 60 Query: 243 YFLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 410 YFLIRKRIHLRPEDALFFFVNNVIPPTSATMG LYQEHH+EDFFLYIA+SDE+VYG Sbjct: 61 YFLIRKRIHLRPEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYG 116 >SB_13547| Best HMM Match : MAP1_LC3 (HMM E-Value=0) Length = 140 Score = 94.7 bits (225), Expect = 5e-20 Identities = 48/115 (41%), Positives = 71/115 (61%), Gaps = 2/115 (1%) Frame = +3 Query: 75 YKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKAR-LGDLDKKKYLVPSDLTVGQFYFL 251 +K+ SF R+ E IR K+P ++PVIVE+ K + L LDK K+LVP +LT+ QF + Sbjct: 14 FKQRKSFVSRRDEVAGIRAKFPSKIPVIVERYHKEKDLPLLDKTKFLVPQELTMSQFVTI 73 Query: 252 IRKRIHLRPEDALFFFVNN-VIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYGN 413 IR R+ L A + VNN + S TM LY+E DED FLY+ ++ + ++G+ Sbjct: 74 IRNRMSLSSTQAFYLIVNNKSLASMSMTMAELYREEKDEDGFLYMVYASQEMFGS 128 >SB_52412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 485 Score = 29.1 bits (62), Expect = 2.8 Identities = 15/54 (27%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = -2 Query: 404 DIFVGKC-YV*KEIFIMVFLVERPHCCRCGWNDIVHEEEKCVFRPQVNTFPDQE 246 D+ VG C Y + L +RP +++V ++++ VF+P +T DQ+ Sbjct: 132 DLAVGYCQYDHLASVLTQLLTDRPEASTEILDELVRDKKRAVFKPNFDTIQDQQ 185 >SB_55930| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 643 Score = 28.7 bits (61), Expect = 3.7 Identities = 18/52 (34%), Positives = 29/52 (55%) Frame = -2 Query: 443 NYLKVNNLELISIDIFVGKCYV*KEIFIMVFLVERPHCCRCGWNDIVHEEEK 288 N L+ NN +L + +F G C+V K + IM FLV C R + + +++K Sbjct: 586 NCLEYNNTQL-AYTVF-GLCFVCKLVVIMGFLVSYLSCRRINKSTRLRQDDK 635 >SB_13733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1455 Score = 28.7 bits (61), Expect = 3.7 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +3 Query: 144 RVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFYFLIRKRIHLR 275 RV + + + + D K YL P D G+FY L +IH+R Sbjct: 214 RVTTYINRMHTDGIINQDTKSYLTPKDSKPGRFYIL--PKIHIR 255 >SB_40533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 319 Score = 28.3 bits (60), Expect = 4.9 Identities = 14/46 (30%), Positives = 21/46 (45%) Frame = +3 Query: 141 DRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRP 278 +RV + + + + D K YL P D G+FY L + H P Sbjct: 81 ERVTTYINRMHTDGIINQDTKSYLTPKDSKPGRFYILPKIHKHGNP 126 >SB_42248| Best HMM Match : Keratin_B2 (HMM E-Value=4.4) Length = 736 Score = 27.9 bits (59), Expect = 6.5 Identities = 19/80 (23%), Positives = 35/80 (43%), Gaps = 4/80 (5%) Frame = +2 Query: 326 CNNGVSLPRTP**RFLSIHSIFRRKCLWKLIPNYSLSNS----FTLSDHMVKFNLSLRLK 493 C N SLP P + + ++ +++C +Y L + F+ SD + L L Sbjct: 383 CGNRGSLPPPPPGQLAKLLAVRQKQCEKYPTSHYMLKVAHLQYFSYSDSKINSKLKLNYV 442 Query: 494 LCIILWYFFIINWHIILYLS 553 LC+ W + H++ +S Sbjct: 443 LCLNTWLSDQFDKHMVYIVS 462 >SB_56499| Best HMM Match : MFS_1 (HMM E-Value=0.29) Length = 274 Score = 27.5 bits (58), Expect = 8.6 Identities = 13/49 (26%), Positives = 27/49 (55%), Gaps = 2/49 (4%) Frame = +2 Query: 419 PNYSLSNSFTLSDHMVKFNLSL-RLKLCIILWYFFIINWH-IILYLSSY 559 P+ +++ T+S H+V F ++L +K +YFF H ++++ Y Sbjct: 172 PSVDFTSALTVSKHLVTFAVTLDHIKRFFTFFYFFDAECHNVVVFQGRY 220 >SB_55747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 228 Score = 27.5 bits (58), Expect = 8.6 Identities = 14/45 (31%), Positives = 20/45 (44%) Frame = +3 Query: 144 RVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRP 278 RV + + + + D K YL P D G+FY L + H P Sbjct: 158 RVTTYINRMHTDGIINQDTKSYLTPKDSKPGRFYILPKIHKHGNP 202 >SB_47703| Best HMM Match : GIY-YIG (HMM E-Value=0.56) Length = 640 Score = 27.5 bits (58), Expect = 8.6 Identities = 14/45 (31%), Positives = 20/45 (44%) Frame = +3 Query: 144 RVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRP 278 RV + + + + D K YL P D G+FY L + H P Sbjct: 77 RVTTYINRMHTDGIINQDTKSYLTPKDSKPGRFYILPKIHKHGNP 121 >SB_46172| Best HMM Match : Peptidase_C54 (HMM E-Value=1) Length = 417 Score = 27.5 bits (58), Expect = 8.6 Identities = 14/45 (31%), Positives = 20/45 (44%) Frame = +3 Query: 144 RVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRP 278 RV + + + + D K YL P D G+FY L + H P Sbjct: 34 RVTTYINRMHTDGIINQDTKSYLTPKDSKPGRFYILPKIHKHGNP 78 >SB_397| Best HMM Match : MFS_1 (HMM E-Value=0.16) Length = 394 Score = 27.5 bits (58), Expect = 8.6 Identities = 14/45 (31%), Positives = 20/45 (44%) Frame = +3 Query: 144 RVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRP 278 RV + + + + D K YL P D G+FY L + H P Sbjct: 324 RVTTYINRMHTDGIINQDTKSYLTPKDSKPGRFYILPKIHKHGNP 368 >SB_47833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 302 Score = 27.5 bits (58), Expect = 8.6 Identities = 14/45 (31%), Positives = 20/45 (44%) Frame = +3 Query: 144 RVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRP 278 RV + + + + D K YL P D G+FY L + H P Sbjct: 232 RVTTYINRMHTDGIINQDTKSYLTPKDSKPGRFYILPKIHKHGNP 276 >SB_39196| Best HMM Match : Phage_GP20 (HMM E-Value=3.9) Length = 201 Score = 27.5 bits (58), Expect = 8.6 Identities = 14/45 (31%), Positives = 20/45 (44%) Frame = +3 Query: 144 RVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRP 278 RV + + + + D K YL P D G+FY L + H P Sbjct: 131 RVTTYINRMHTDGIINQDTKSYLTPKDSKPGRFYILPKIHKHGNP 175 >SB_29369| Best HMM Match : GIY-YIG (HMM E-Value=0.56) Length = 785 Score = 27.5 bits (58), Expect = 8.6 Identities = 14/45 (31%), Positives = 20/45 (44%) Frame = +3 Query: 144 RVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRP 278 RV + + + + D K YL P D G+FY L + H P Sbjct: 450 RVTTYINRMHTDGIINQDTKSYLTPKDSKPGRFYILPKIHKHGNP 494 >SB_413| Best HMM Match : Phage_GP20 (HMM E-Value=3.9) Length = 179 Score = 27.5 bits (58), Expect = 8.6 Identities = 14/45 (31%), Positives = 20/45 (44%) Frame = +3 Query: 144 RVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRP 278 RV + + + + D K YL P D G+FY L + H P Sbjct: 109 RVTTYINRMHTDGIINQDTKSYLTPKDSKPGRFYILPKIHKHGNP 153 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,369,365 Number of Sequences: 59808 Number of extensions: 332000 Number of successful extensions: 769 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 731 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 767 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1422302661 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -