BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10b10f (588 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g05630.1 68415.m00599 autophagy 8d (APG8d) identical to autop... 159 1e-39 At4g16520.2 68417.m02501 autophagy 8f (APG8f) identical to autop... 154 4e-38 At4g16520.1 68417.m02500 autophagy 8f (APG8f) identical to autop... 154 4e-38 At2g45170.2 68415.m05624 autophagy 8e (APG8e) identical to autop... 153 1e-37 At2g45170.1 68415.m05623 autophagy 8e (APG8e) identical to autop... 153 1e-37 At3g60640.1 68416.m06785 autophagy 8g (APG8g) identical to autop... 152 2e-37 At4g21980.1 68417.m03182 autophagy 8a (APG8a) identical to autop... 146 1e-35 At4g04620.2 68417.m00676 autophagy 8b (APG8b) identical to autop... 144 3e-35 At4g04620.1 68417.m00675 autophagy 8b (APG8b) identical to autop... 144 3e-35 At1g62040.1 68414.m06997 autophagy 8c (APG8c) identical to autop... 144 3e-35 At3g15580.1 68416.m01974 autophagy 8i (APG8i) identical to autop... 122 2e-28 At3g06420.1 68416.m00740 autophagy 8h (APG8h) identical to autop... 118 4e-27 At5g06680.1 68418.m00754 tubulin family protein similar to SP|Q9... 30 1.00 At3g01015.1 68416.m00001 expressed protein ; expression supporte... 29 3.0 At2g17260.1 68415.m01993 glutamate receptor family protein (GLR3... 28 4.0 At1g49050.1 68414.m05500 aspartyl protease family protein contai... 28 4.0 At1g45150.1 68414.m05176 expressed protein 27 9.3 >At2g05630.1 68415.m00599 autophagy 8d (APG8d) identical to autophagy 8d [Arabidopsis thaliana] GI:19912157; contains Pfam profile PF02991: Microtubule associated protein 1A/1B, light chain 3 Length = 120 Score = 159 bits (387), Expect = 1e-39 Identities = 67/112 (59%), Positives = 91/112 (81%) Frame = +3 Query: 75 YKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFYFLI 254 +K EH EKR+AE +IR KYPDR+PVIVE+A K+ + D+D+KKYLVP+DLTVGQF +++ Sbjct: 6 FKHEHPLEKRQAEAARIREKYPDRIPVIVERAEKSDVPDIDRKKYLVPADLTVGQFVYVV 65 Query: 255 RKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 410 RKRI L PE A+F FV N++PPT+A M ++Y+EH DED FLY+++S EN +G Sbjct: 66 RKRIKLSPEKAIFIFVKNILPPTAAIMSAIYEEHKDEDGFLYMSYSGENTFG 117 >At4g16520.2 68417.m02501 autophagy 8f (APG8f) identical to autophagy 8f [Arabidopsis thaliana] GI:19912161; contains Pfam profile PF02991: Microtubule associated protein 1A/1B, light chain 3 Length = 121 Score = 154 bits (374), Expect = 4e-38 Identities = 68/115 (59%), Positives = 88/115 (76%) Frame = +3 Query: 66 KFQYKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFY 245 K +K+EH EKR+AE +IR KYPDR+PVIVEKA K+ + +DKKKYLVP+DLTVGQF Sbjct: 3 KSSFKQEHDLEKRRAEAARIREKYPDRIPVIVEKAEKSDIPTIDKKKYLVPADLTVGQFV 62 Query: 246 FLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 410 ++IRKRI L E A+F FV+NV+PP A M S+Y+E D+D FLY+ +S EN +G Sbjct: 63 YVIRKRIKLSAEKAIFIFVDNVLPPAGALMSSVYEEKKDDDGFLYVTYSGENTFG 117 >At4g16520.1 68417.m02500 autophagy 8f (APG8f) identical to autophagy 8f [Arabidopsis thaliana] GI:19912161; contains Pfam profile PF02991: Microtubule associated protein 1A/1B, light chain 3 Length = 121 Score = 154 bits (374), Expect = 4e-38 Identities = 68/115 (59%), Positives = 88/115 (76%) Frame = +3 Query: 66 KFQYKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFY 245 K +K+EH EKR+AE +IR KYPDR+PVIVEKA K+ + +DKKKYLVP+DLTVGQF Sbjct: 3 KSSFKQEHDLEKRRAEAARIREKYPDRIPVIVEKAEKSDIPTIDKKKYLVPADLTVGQFV 62 Query: 246 FLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 410 ++IRKRI L E A+F FV+NV+PP A M S+Y+E D+D FLY+ +S EN +G Sbjct: 63 YVIRKRIKLSAEKAIFIFVDNVLPPAGALMSSVYEEKKDDDGFLYVTYSGENTFG 117 >At2g45170.2 68415.m05624 autophagy 8e (APG8e) identical to autophagy 8e [Arabidopsis thaliana] GI:19912159; contains Pfam profile PF02991: Microtubule associated protein 1A/1B, light chain 3 Length = 122 Score = 153 bits (370), Expect = 1e-37 Identities = 69/112 (61%), Positives = 87/112 (77%) Frame = +3 Query: 75 YKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFYFLI 254 +K + FEKRKAE +IR KYPDR+PVIVEKA K+ + ++DKKKYLVPSDLTVGQF ++I Sbjct: 7 FKMDDDFEKRKAEAGRIREKYPDRIPVIVEKAEKSEVPNIDKKKYLVPSDLTVGQFVYVI 66 Query: 255 RKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 410 RKRI L E A+F FV+NV+PPT M S+Y++ DED FLYI +S EN +G Sbjct: 67 RKRIKLSAEKAIFIFVDNVLPPTGELMSSVYEDKKDEDGFLYITYSGENTFG 118 >At2g45170.1 68415.m05623 autophagy 8e (APG8e) identical to autophagy 8e [Arabidopsis thaliana] GI:19912159; contains Pfam profile PF02991: Microtubule associated protein 1A/1B, light chain 3 Length = 122 Score = 153 bits (370), Expect = 1e-37 Identities = 69/112 (61%), Positives = 87/112 (77%) Frame = +3 Query: 75 YKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFYFLI 254 +K + FEKRKAE +IR KYPDR+PVIVEKA K+ + ++DKKKYLVPSDLTVGQF ++I Sbjct: 7 FKMDDDFEKRKAEAGRIREKYPDRIPVIVEKAEKSEVPNIDKKKYLVPSDLTVGQFVYVI 66 Query: 255 RKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 410 RKRI L E A+F FV+NV+PPT M S+Y++ DED FLYI +S EN +G Sbjct: 67 RKRIKLSAEKAIFIFVDNVLPPTGELMSSVYEDKKDEDGFLYITYSGENTFG 118 >At3g60640.1 68416.m06785 autophagy 8g (APG8g) identical to autophagy 8g [Arabidopsis thaliana] GI:19912163; contains Pfam profile PF02991: Microtubule associated protein 1A/1B, light chain 3; supporting cDNA gi|19912162|dbj|AB073181.1| Length = 121 Score = 152 bits (368), Expect = 2e-37 Identities = 66/113 (58%), Positives = 90/113 (79%) Frame = +3 Query: 75 YKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFYFLI 254 ++++H FEKRKAE +IR KY DRVPVIVEK+ K+ + ++DKKKYLVP+DLTVGQF ++I Sbjct: 6 FRQDHDFEKRKAEALRIREKYSDRVPVIVEKSEKSDIPNIDKKKYLVPADLTVGQFVYVI 65 Query: 255 RKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYGN 413 RKRI L E A+F FV+NV+PPT A M ++Y E+ +ED FLY+ +S EN +G+ Sbjct: 66 RKRIQLSAEKAIFIFVDNVLPPTGAMMSTIYDENKEEDGFLYVTYSGENTFGS 118 >At4g21980.1 68417.m03182 autophagy 8a (APG8a) identical to autophagy 8a [Arabidopsis thaliana] GI:19912151; contains Pfam profile PF02991: Microtubule associated protein 1A/1B, light chain 3 Length = 122 Score = 146 bits (353), Expect = 1e-35 Identities = 64/116 (55%), Positives = 87/116 (75%) Frame = +3 Query: 66 KFQYKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFY 245 K +K + E R +E +IR KYPDR+PVIVEKA ++ + D+DKKKYLVP+DLTVGQF Sbjct: 3 KSSFKISNPLEARMSESSRIREKYPDRIPVIVEKAGQSDVPDIDKKKYLVPADLTVGQFV 62 Query: 246 FLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYGN 413 +++RKRI L E A+F FV N +PPT+A M ++Y+EH DED FLY+ +S EN +G+ Sbjct: 63 YVVRKRIKLGAEKAIFVFVKNTLPPTAALMSAIYEEHKDEDGFLYMTYSGENTFGS 118 >At4g04620.2 68417.m00676 autophagy 8b (APG8b) identical to autophagy 8b [Arabidopsis thaliana] GI:19912153; contains Pfam profile PF02991: Microtubule associated protein 1A/1B, light chain 3 Length = 122 Score = 144 bits (350), Expect = 3e-35 Identities = 65/118 (55%), Positives = 87/118 (73%) Frame = +3 Query: 66 KFQYKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFY 245 K +K + E R AE +IR KYP+RVPVIVEKA ++ + D+DKKKYLVP+DLT+GQF Sbjct: 3 KNSFKLSNPLEMRMAESTRIRAKYPERVPVIVEKAGQSDVPDIDKKKYLVPADLTIGQFV 62 Query: 246 FLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYGN*F 419 +++RKRI L E A+F FV N +PPT+A M ++Y+EH DED FLY+ +S EN +G F Sbjct: 63 YVVRKRIKLGAEKAIFVFVKNTLPPTAALMSAIYEEHKDEDGFLYMTYSGENTFGGSF 120 >At4g04620.1 68417.m00675 autophagy 8b (APG8b) identical to autophagy 8b [Arabidopsis thaliana] GI:19912153; contains Pfam profile PF02991: Microtubule associated protein 1A/1B, light chain 3 Length = 122 Score = 144 bits (350), Expect = 3e-35 Identities = 65/118 (55%), Positives = 87/118 (73%) Frame = +3 Query: 66 KFQYKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFY 245 K +K + E R AE +IR KYP+RVPVIVEKA ++ + D+DKKKYLVP+DLT+GQF Sbjct: 3 KNSFKLSNPLEMRMAESTRIRAKYPERVPVIVEKAGQSDVPDIDKKKYLVPADLTIGQFV 62 Query: 246 FLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYGN*F 419 +++RKRI L E A+F FV N +PPT+A M ++Y+EH DED FLY+ +S EN +G F Sbjct: 63 YVVRKRIKLGAEKAIFVFVKNTLPPTAALMSAIYEEHKDEDGFLYMTYSGENTFGGSF 120 >At1g62040.1 68414.m06997 autophagy 8c (APG8c) identical to autophagy 8c [Arabidopsis thaliana] GI:19912155; contains Pfam profile PF02991: Microtubule associated protein 1A/1B, light chain 3 Length = 119 Score = 144 bits (350), Expect = 3e-35 Identities = 62/112 (55%), Positives = 86/112 (76%) Frame = +3 Query: 75 YKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFYFLI 254 +K EH E+R+ E +IR KYPDR+PVIVE+A ++ + ++DKKKYLVP+DLTVGQF +++ Sbjct: 6 FKLEHPLERRQIESSRIREKYPDRIPVIVERAERSDVPNIDKKKYLVPADLTVGQFVYVV 65 Query: 255 RKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 410 RKRI L E A+F FV N +PPT+A M ++Y E+ DED FLY+ +S EN +G Sbjct: 66 RKRIKLSAEKAIFVFVKNTLPPTAAMMSAIYDENKDEDGFLYMTYSGENTFG 117 >At3g15580.1 68416.m01974 autophagy 8i (APG8i) identical to autophagy 8i [Arabidopsis thaliana] GI:19912167; contains Pfam profile PF02991: Microtubule associated protein 1A/1B, light chain 3; supporting cDNA gi|21636957|gb|AF492760.1| Length = 115 Score = 122 bits (293), Expect = 2e-28 Identities = 52/112 (46%), Positives = 79/112 (70%) Frame = +3 Query: 75 YKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFYFLI 254 +KE+++ ++R AE +I KYP R+PVI EK K L ++KKK+LVP D++VGQF +++ Sbjct: 4 FKEQYTLDERLAESREIIAKYPTRIPVIAEKYCKTDLPAIEKKKFLVPRDMSVGQFIYIL 63 Query: 255 RKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 410 R+HL P ALF FVNN +P T+A M S+Y+ + D+D F+Y+ +S E +G Sbjct: 64 SARLHLSPGKALFVFVNNTLPQTAALMDSVYESYKDDDGFVYMCYSSEKTFG 115 >At3g06420.1 68416.m00740 autophagy 8h (APG8h) identical to autophagy 8h [Arabidopsis thaliana] GI:19912165; contains Pfam profile PF02991: Microtubule associated protein 1A/1B, light chain 3; supporting cDNA gi|19912164|dbj|AB073182.1| Length = 119 Score = 118 bits (283), Expect = 4e-27 Identities = 53/112 (47%), Positives = 74/112 (66%) Frame = +3 Query: 75 YKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFYFLI 254 +K++ S ++R E I KYPDR+PVI+EK A L D++K KYLVP D+TVG F ++ Sbjct: 8 FKDQFSSDERLKESNNIIAKYPDRIPVIIEKYSNADLPDMEKNKYLVPRDMTVGHFIHML 67 Query: 255 RKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 410 KR+ L P ALF FV+N +P T++ M SLY +ED FLY+ +S E +G Sbjct: 68 SKRMQLDPSKALFVFVHNTLPQTASRMDSLYNTFKEEDGFLYMCYSTEKTFG 119 >At5g06680.1 68418.m00754 tubulin family protein similar to SP|Q96CW5 Gamma-tubulin complex component 3 {Homo sapiens} Length = 838 Score = 30.3 bits (65), Expect = 1.00 Identities = 15/37 (40%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = +2 Query: 404 LWKLI-PNYSLSNSFTLSDHMVKFNLSLRLKLCIILW 511 +WK + PN SNSF VK L L+ C +LW Sbjct: 622 IWKTMKPNCITSNSFVKLQSSVKLQLLSALRRCQVLW 658 >At3g01015.1 68416.m00001 expressed protein ; expression supported by MPSS Length = 488 Score = 28.7 bits (61), Expect = 3.0 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = +3 Query: 57 INMKFQYKEEHSFEKRKAEGEKIRRKYPDRVP 152 IN+ QYK E +++ AE E+IRR + VP Sbjct: 396 INLVEQYKTERERQQKLAEEEEIRRLRKELVP 427 >At2g17260.1 68415.m01993 glutamate receptor family protein (GLR3.1) (GLR2) identical to putative glutamate receptor GLR2 [Arabidopsis thaliana] gi|4185740|gb|AAD09174; plant glutamate receptor family, PMID:11379626 Length = 951 Score = 28.3 bits (60), Expect = 4.0 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +2 Query: 446 TLSDHMVKFNLSLRLKLCIILWYFFIINWHIILYL 550 T S H K +L LK ++ +FF +NW ++ ++ Sbjct: 5 TFSFHFSKVSLCFLLKQLLLYGFFFSMNWVLLSFI 39 >At1g49050.1 68414.m05500 aspartyl protease family protein contains Pfam PF00026: Eukaryotic aspartyl protease; contains similarity to nucellin GI:2290203 from [Hordeum vulgare] Length = 583 Score = 28.3 bits (60), Expect = 4.0 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = +3 Query: 195 DKKKYLVPSDLTVGQFYFLIRKRIHLRPEDAL 290 D KK+ P L +G + +I +++ ++PED L Sbjct: 485 DVKKFFRPITLQIGSKWLIISRKLLIQPEDYL 516 >At1g45150.1 68414.m05176 expressed protein Length = 643 Score = 27.1 bits (57), Expect = 9.3 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +2 Query: 428 SLSNSFTLSDHMVKFNLSLRLKLCIILWYFFI 523 S + S + + V NLSLR+KL + +W F I Sbjct: 245 STNGSTDMMEEDVVSNLSLRIKLRLTVWEFII 276 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,711,573 Number of Sequences: 28952 Number of extensions: 241657 Number of successful extensions: 741 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 719 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 740 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1161268208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -