BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10b09r (756 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g02190.2 68414.m00150 CER1 protein, putative similar to CER1 ... 31 0.83 At1g02190.1 68414.m00149 CER1 protein, putative similar to CER1 ... 31 0.83 At3g13530.1 68416.m01701 MAP3K epsilon protein kinase identical ... 31 1.1 At3g03480.1 68416.m00346 transferase family protein similar to h... 31 1.1 At2g17250.1 68415.m01992 expressed protein weak similarity to Ri... 30 1.9 At1g10760.1 68414.m01231 starch excess protein (SEX1) identical ... 29 3.3 At4g13390.1 68417.m02092 proline-rich extensin-like family prote... 29 4.4 At5g49060.1 68418.m06070 DNAJ heat shock N-terminal domain-conta... 28 5.8 At5g14580.1 68418.m01710 polyribonucleotide nucleotidyltransfera... 28 5.8 At5g06630.1 68418.m00749 proline-rich extensin-like family prote... 28 5.8 At4g18030.1 68417.m02684 dehydration-responsive family protein s... 28 7.7 At3g28550.1 68416.m03565 proline-rich extensin-like family prote... 28 7.7 At3g07980.1 68416.m00975 protein kinase, putative similar to MAP... 28 7.7 At1g23720.1 68414.m02994 proline-rich extensin-like family prote... 28 7.7 >At1g02190.2 68414.m00150 CER1 protein, putative similar to CER1 GI:1199467 and maize gl1 homolog (glossy1 locus) GI:1209703 from [Arabidopsis thaliana] Length = 623 Score = 31.1 bits (67), Expect = 0.83 Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = -2 Query: 239 TNHSVIHSIAPFFLSTSNNLTCS-SRRSWSTMKENYSPIYLTFLTIH 102 TN+S+ I F T++NLT S RS +E+ I+LT LT H Sbjct: 257 TNYSLFMPIYDFIYGTTDNLTDSLYERSLEIEEESPDVIHLTHLTTH 303 >At1g02190.1 68414.m00149 CER1 protein, putative similar to CER1 GI:1199467 and maize gl1 homolog (glossy1 locus) GI:1209703 from [Arabidopsis thaliana] Length = 627 Score = 31.1 bits (67), Expect = 0.83 Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = -2 Query: 239 TNHSVIHSIAPFFLSTSNNLTCS-SRRSWSTMKENYSPIYLTFLTIH 102 TN+S+ I F T++NLT S RS +E+ I+LT LT H Sbjct: 257 TNYSLFMPIYDFIYGTTDNLTDSLYERSLEIEEESPDVIHLTHLTTH 303 >At3g13530.1 68416.m01701 MAP3K epsilon protein kinase identical to MAP3K epsilon protein kinase [Arabidopsis thaliana] gi|3549652|emb|CAA12272 Length = 1368 Score = 30.7 bits (66), Expect = 1.1 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = +2 Query: 269 DSLGVGSYG*TNTNSWKGNPSYVPLGSISLEGIVSEELN 385 D +G G+YG N +V + +SLE IV E+LN Sbjct: 24 DEIGKGAYGRVYKGLDLENGDFVAIKQVSLENIVQEDLN 62 >At3g03480.1 68416.m00346 transferase family protein similar to hypersensitivity-related gene GB:CAA64636 [Nicotiana tabacum]; contains Pfam transferase family domain PF00248 Length = 454 Score = 30.7 bits (66), Expect = 1.1 Identities = 22/68 (32%), Positives = 36/68 (52%), Gaps = 4/68 (5%) Frame = -1 Query: 366 MPSRLMLPKGTYDGFPFQLF----VFVYPYEPTPKESEPFKSVVPDNKPFGYPFDRPVLP 199 M ++ LP+ T G F++ V P +PTP+E +P S + D + G F PV+ Sbjct: 1 MDHQVSLPQSTTTGLSFKVHRQQRELVTPAKPTPRELKPL-SDIDDQQ--GLRFQIPVI- 56 Query: 198 QYFKQPNM 175 +F +PN+ Sbjct: 57 -FFYRPNL 63 >At2g17250.1 68415.m01992 expressed protein weak similarity to Ribosome biogenesis protein MAK21 (Swiss-Prot:Q12176) [Saccharomyces cerevisiae] Length = 577 Score = 29.9 bits (64), Expect = 1.9 Identities = 18/48 (37%), Positives = 26/48 (54%) Frame = -2 Query: 749 MPSTLSTSVKKNSRALLTVTRSVNHVLTTSRSL*QSILNLMLPLTPSS 606 M S LS KKN + L +S+ H L TSRS ++ L+ ++P S Sbjct: 1 MASILSKKQKKNEKYTLKELKSLGHDLLTSRSHINNLPLLLTFVSPES 48 >At1g10760.1 68414.m01231 starch excess protein (SEX1) identical to SEX1 [Arabidopsis thaliana] GI:12044358; supporting cDNA gi|12044357|gb|AF312027.1|AF312027 Length = 1399 Score = 29.1 bits (62), Expect = 3.3 Identities = 18/49 (36%), Positives = 26/49 (53%) Frame = +2 Query: 248 TTDLNGSDSLGVGSYG*TNTNSWKGNPSYVPLGSISLEGIVSEELNMSV 394 T+DL G+ S +G Y SW G P+ V L E ++SE+ N +V Sbjct: 1089 TSDLVGAKSRNIG-YLKGKVPSWVGIPTSVALPFGVFEKVISEKANQAV 1136 >At4g13390.1 68417.m02092 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 429 Score = 28.7 bits (61), Expect = 4.4 Identities = 25/98 (25%), Positives = 37/98 (37%), Gaps = 1/98 (1%) Frame = -1 Query: 396 PTDMFNSSDTMPSRLMLPKGTYDGFPFQLFVFVYPYEPTPKESEPFKSVVPDNKPFGYPF 217 P ++NS P P Y P +VY P P PF V + P Y + Sbjct: 342 PPYVYNSPPPPPYYSPSPTVNYKSPPPP---YVYNSPPPPPYYSPFPKVEYKSPPPPYIY 398 Query: 216 DRPVLPQYFK-QPNMFFKKVLVYHEGELFPYLFNIPHY 106 + P P Y+ P + +K PY++ P+Y Sbjct: 399 NSPPPPPYYSPSPKITYKSPPP-------PYIYKTPYY 429 >At5g49060.1 68418.m06070 DNAJ heat shock N-terminal domain-containing protein low similarity to SP|Q9QYI4 DnaJ homolog subfamily B member 12 {Mus musculus}; contains Pfam profile PF00226: DnaJ domain Length = 354 Score = 28.3 bits (60), Expect = 5.8 Identities = 13/52 (25%), Positives = 25/52 (48%) Frame = -1 Query: 750 DAFNTVYFSKEELKSSPHGYKVRQPRLNHKPFTVTIDIKSDVATNAVVKMFL 595 + F TV+ + E+ + H Y+ RQPR + + + S + ++ FL Sbjct: 197 EIFRTVFGQQREVFRASHAYRTRQPRNQFREEEINVAGPSCLTIIQILPFFL 248 >At5g14580.1 68418.m01710 polyribonucleotide nucleotidyltransferase, putative similar to Swiss-Prot:P05055 polyribonucleotide nucleotidyltransferase (EC 2.7.7.8) (Polynucleotide phosphorylase) (PNPase) [Escherichia coli] Length = 991 Score = 28.3 bits (60), Expect = 5.8 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = -2 Query: 224 IHSIAPFFLSTSNNLTCSSRRSWSTMKENYS 132 + S++P ST++NL S+ STMKEN S Sbjct: 877 LKSVSPKNNSTASNLVSFSKAKKSTMKENLS 907 >At5g06630.1 68418.m00749 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 440 Score = 28.3 bits (60), Expect = 5.8 Identities = 15/46 (32%), Positives = 21/46 (45%) Frame = -1 Query: 303 FVYPYEPTPKESEPFKSVVPDNKPFGYPFDRPVLPQYFKQPNMFFK 166 +VY P P S P V + P Y + P P Y PN+++K Sbjct: 308 YVYSSPPPPYYS-PSPKVYYKSPPPPYVYSSPPPPYYSPSPNVYYK 352 >At4g18030.1 68417.m02684 dehydration-responsive family protein similar to early-responsive to dehydration stress ERD3 protein [Arabidopsis thaliana] GI:15320410; contains Pfam profile PF03141: Putative methyltransferase Length = 621 Score = 27.9 bits (59), Expect = 7.7 Identities = 15/54 (27%), Positives = 23/54 (42%) Frame = -1 Query: 300 VYPYEPTPKESEPFKSVVPDNKPFGYPFDRPVLPQYFKQPNMFFKKVLVYHEGE 139 +Y P ++E + +VP K + PF P Y N FK + V G+ Sbjct: 113 IYRERHCPPDNEKLRCLVPAPKGYMTPFPWPKSRDYVHYANAPFKSLTVEKAGQ 166 >At3g28550.1 68416.m03565 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 1018 Score = 27.9 bits (59), Expect = 7.7 Identities = 15/46 (32%), Positives = 21/46 (45%) Frame = -1 Query: 303 FVYPYEPTPKESEPFKSVVPDNKPFGYPFDRPVLPQYFKQPNMFFK 166 +VY P P S P VV + P Y + P P Y P +++K Sbjct: 567 YVYSSPPPPYYS-PSPKVVYKSPPPPYVYSSPPPPYYSPSPKVYYK 611 >At3g07980.1 68416.m00975 protein kinase, putative similar to MAP3K epsilon protein kinase [Arabidopsis thaliana] gi|3549652|emb|CAA12272 Length = 1367 Score = 27.9 bits (59), Expect = 7.7 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = +2 Query: 269 DSLGVGSYG*TNTNSWKGNPSYVPLGSISLEGIVSEELN 385 D +G G+YG N +V + +SLE I E+LN Sbjct: 24 DEIGKGAYGRVYIGLDLENGDFVAIKQVSLENIGQEDLN 62 >At1g23720.1 68414.m02994 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 895 Score = 27.9 bits (59), Expect = 7.7 Identities = 22/77 (28%), Positives = 27/77 (35%) Frame = -1 Query: 396 PTDMFNSSDTMPSRLMLPKGTYDGFPFQLFVFVYPYEPTPKESEPFKSVVPDNKPFGYPF 217 P SS P PK TY P +VY P P P V + P Y + Sbjct: 710 PPPYVYSSPPPPYYSPSPKPTYKSPPPP---YVYSSPPPPPYYSPSPKVEYKSPPPPYVY 766 Query: 216 DRPVLPQYFKQPNMFFK 166 P P Y P + +K Sbjct: 767 SSPPPPYYSPSPKVEYK 783 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,845,200 Number of Sequences: 28952 Number of extensions: 312959 Number of successful extensions: 1151 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 917 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1138 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1682736544 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -