BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10b07r (721 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_8761| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.0 SB_36070| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_53580| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.8 SB_12922| Best HMM Match : MFS_1 (HMM E-Value=1.1) 28 8.8 >SB_8761| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 221 Score = 28.7 bits (61), Expect = 5.0 Identities = 13/42 (30%), Positives = 24/42 (57%) Frame = +1 Query: 352 PTSNSTSTVKANVTKATLTRRPCPTTQIGIRKNIN*QITTSK 477 P N T T A +TKA+ + P PT ++ I + + ++T ++ Sbjct: 174 PKLNPTLTCHARLTKASDSNDPVPTLELTIESSTSGRVTENR 215 >SB_36070| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 28.3 bits (60), Expect = 6.6 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +2 Query: 392 LKQH*HADRVPQRKLEYAKTLIDKLQRVSMWC 487 LK + ADR+P L+ + ID +VS WC Sbjct: 29 LKPNQTADRIPYLSLDTSYVAIDMRTQVSEWC 60 >SB_53580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 940 Score = 27.9 bits (59), Expect = 8.8 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +2 Query: 599 ICCLSGLVANDETAQCFWIGMFLSVMASCGNGASTVSTPS 718 + L+ +AN+ T + WIG F +V S G +S P+ Sbjct: 61 LATLTASIANNSTRKKLWIGAFFTVDISDGGWSSAGVLPA 100 >SB_12922| Best HMM Match : MFS_1 (HMM E-Value=1.1) Length = 473 Score = 27.9 bits (59), Expect = 8.8 Identities = 17/52 (32%), Positives = 29/52 (55%) Frame = +1 Query: 316 NSFLLQSRQIIIPTSNSTSTVKANVTKATLTRRPCPTTQIGIRKNIN*QITT 471 ++F+L +I T ++T V + ++ TL PTT + I++NI ITT Sbjct: 122 STFILSYNTTVIATPDTTRFVTSTISSFTLNESANPTTSL-IQQNIT-LITT 171 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,379,076 Number of Sequences: 59808 Number of extensions: 361605 Number of successful extensions: 592 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 539 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 592 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1913853903 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -