BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10b06f (640 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_24524| Best HMM Match : Proteasome (HMM E-Value=1.4013e-45) 239 2e-63 SB_6379| Best HMM Match : Proteasome (HMM E-Value=0) 76 3e-14 SB_10931| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_48652| Best HMM Match : RVT_1 (HMM E-Value=0.0009) 33 0.20 SB_6320| Best HMM Match : Exo_endo_phos (HMM E-Value=4.8) 29 3.2 SB_50142| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_23884| Best HMM Match : IBN_N (HMM E-Value=0.092) 28 5.6 SB_6030| Best HMM Match : rve (HMM E-Value=8.7e-30) 28 7.4 SB_15422| Best HMM Match : TACC (HMM E-Value=6.4e-20) 27 9.7 SB_6455| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 >SB_24524| Best HMM Match : Proteasome (HMM E-Value=1.4013e-45) Length = 291 Score = 239 bits (584), Expect = 2e-63 Identities = 110/189 (58%), Positives = 140/189 (74%) Frame = +2 Query: 74 YKMLSVNENFPEYAVPGAKQHRFEPYADNGGSIVAIAGDDYAVIGADTRLSTGFSIYTRD 253 Y + + Y KQ F PYA NGG+++AI+G+D+AVI +DTRLS GF I+TRD Sbjct: 58 YSLTKMQVGSESYYGGNPKQTYFSPYAFNGGTVLAISGEDFAVIASDTRLSQGFQIHTRD 117 Query: 254 QKKLFKLSESTVLGATGCWCDTLTLTRLLQARMQMYEHEHNKSMTTPAVAQMLSTMLYYK 433 K++KL+ STVLG +G D LTLT+ + AR+QMYEH+H K+M+ A+AQMLSTMLYY+ Sbjct: 118 SPKVYKLTGSTVLGCSGFHGDCLTLTKHISARLQMYEHDHGKAMSCTAIAQMLSTMLYYR 177 Query: 434 RFFPYYVSNVLAGLDSDGKGCVYSYDPIGHCARHNFRAGGSAAAQLQPLLDNQIGLKNMQ 613 RFFPYY N+LAGLDS+GKGCV+S+DP+G R +RAGGSA+A LQPLLDNQIG KN + Sbjct: 178 RFFPYYTYNILAGLDSEGKGCVFSFDPVGSYEREVYRAGGSASALLQPLLDNQIGFKNQE 237 Query: 614 NVTEAPLPR 640 V PL R Sbjct: 238 GVPHTPLTR 246 >SB_6379| Best HMM Match : Proteasome (HMM E-Value=0) Length = 909 Score = 75.8 bits (178), Expect = 3e-14 Identities = 43/146 (29%), Positives = 74/146 (50%), Gaps = 2/146 (1%) Frame = +2 Query: 158 NGGSIVAIAGDDYAVIGADTRLSTGFSIYTRDQKKLFKLSESTVLGATGCWCDTLTLTRL 337 NG +I+A+ G + I AD RL + D +K+F++ E +G G D T++ Sbjct: 77 NGAAIIAMVGKNCVAIAADRRLGIQAQTVSCDFQKIFQMGEKLFVGLPGLATDVQTISSR 136 Query: 338 LQARMQMYEHEHNKSMTTPAVAQMLSTMLYYKRFFPYYVSNVLAGLD-SDGKGCVYSYDP 514 L+ R+ +YE + + M+S +LY +RF PY+V V+AGLD + + S D Sbjct: 137 LKFRLNLYELREGRPIKPKTFLSMVSNLLYERRFGPYFVEPVIAGLDPKTNEPFISSMDL 196 Query: 515 IG-HCARHNFRAGGSAAAQLQPLLDN 589 IG +F G+ + Q+ + ++ Sbjct: 197 IGCPMETKDFVVSGTCSEQMYGMCES 222 >SB_10931| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 467 Score = 39.1 bits (87), Expect = 0.003 Identities = 21/92 (22%), Positives = 47/92 (51%) Frame = +2 Query: 155 DNGGSIVAIAGDDYAVIGADTRLSTGFSIYTRDQKKLFKLSESTVLGATGCWCDTLTLTR 334 D+G + +A ++ D+R + G I ++ KK+ +++ + G D R Sbjct: 26 DHGTTTLAFKFKHGVIVAVDSRATAGSYIASQTVKKVIEINPYLLGTMAGGAADCSFWER 85 Query: 335 LLQARMQMYEHEHNKSMTTPAVAQMLSTMLYY 430 LL + ++YE + + ++ A +++L+ M+YY Sbjct: 86 LLAKQCRIYELRNKERISVAAASKILANMVYY 117 >SB_48652| Best HMM Match : RVT_1 (HMM E-Value=0.0009) Length = 938 Score = 33.1 bits (72), Expect = 0.20 Identities = 17/64 (26%), Positives = 36/64 (56%) Frame = +2 Query: 161 GGSIVAIAGDDYAVIGADTRLSTGFSIYTRDQKKLFKLSESTVLGATGCWCDTLTLTRLL 340 G S++ I + ++ ADT S G R+ +L +++E+T++GA G + D + +L Sbjct: 875 GTSVLGIKFNGGVLMAADTLGSYGSLARYRNISRLMRVNENTIIGAAGDYADFQYIKSVL 934 Query: 341 QARM 352 + ++ Sbjct: 935 EQKV 938 >SB_6320| Best HMM Match : Exo_endo_phos (HMM E-Value=4.8) Length = 845 Score = 29.1 bits (62), Expect = 3.2 Identities = 20/54 (37%), Positives = 26/54 (48%), Gaps = 2/54 (3%) Frame = +2 Query: 173 VAIAGD--DYAVIGADTRLSTGFSIYTRDQKKLFKLSESTVLGATGCWCDTLTL 328 VA+ D D +GAD R G +IY RD + ++ S A C C TL L Sbjct: 249 VALEADLRDRGWLGADLRSKGGVAIYVRDTISVIEIKRSE---AYECLCVTLDL 299 >SB_50142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 362 Score = 28.7 bits (61), Expect = 4.2 Identities = 14/41 (34%), Positives = 24/41 (58%) Frame = -2 Query: 420 IVESICATAGVVIDLLCSCSYICILACRRRVKVNVSHQQPV 298 +V + A + +V+ LL SC +C L+ R +KV HQ+ + Sbjct: 165 MVSTAKAYSVIVLFLLVSCFLLCFLSYFRLLKVTRRHQRQI 205 >SB_23884| Best HMM Match : IBN_N (HMM E-Value=0.092) Length = 230 Score = 28.3 bits (60), Expect = 5.6 Identities = 14/36 (38%), Positives = 23/36 (63%) Frame = -2 Query: 312 HQQPVAPNTVLSDNLNSFFWSLVYMENPVLRRVSAP 205 +Q+ P+ VLS N + LV ++ PVL++V+AP Sbjct: 28 YQKLKTPHVVLSVNRFFYLRDLVMIQIPVLQKVAAP 63 >SB_6030| Best HMM Match : rve (HMM E-Value=8.7e-30) Length = 1280 Score = 27.9 bits (59), Expect = 7.4 Identities = 14/52 (26%), Positives = 25/52 (48%) Frame = +3 Query: 393 RQSHRCSQLCCITNDFSHTTYPTCWRVWTATVRDVYIVTTLSDTVRAITSAL 548 R+ C+QL T F+++ + R+W DV + TL+ A+ A+ Sbjct: 1217 RKELYCNQLQANTLTFNYSFFARAIRIWNLLPNDVKSINTLAKYKAAVQPAV 1268 >SB_15422| Best HMM Match : TACC (HMM E-Value=6.4e-20) Length = 1362 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/37 (29%), Positives = 19/37 (51%), Gaps = 2/37 (5%) Frame = -2 Query: 390 VVIDLLCSCSYICILACRRR--VKVNVSHQQPVAPNT 286 V ++L+C SY+ + +C R ++ N H P T Sbjct: 428 VSLELVCCYSYVMVSSCSERCTIRYNAMHNNPCLSRT 464 >SB_6455| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +2 Query: 242 YTRDQKKLFKLSESTVLGATGCWCDTLTLT 331 + + Q K+F S V TG WCD L ++ Sbjct: 25 WAKMQNKVFGPENSRVFRETGAWCDLLGMS 54 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,150,338 Number of Sequences: 59808 Number of extensions: 462925 Number of successful extensions: 1257 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1121 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1254 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1608851125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -