BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10b05r (707 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC36B7.03 |sec63||ER protein translocation subcomplex subunit ... 27 3.5 >SPBC36B7.03 |sec63||ER protein translocation subcomplex subunit Sec63 |Schizosaccharomyces pombe|chr 2|||Manual Length = 611 Score = 26.6 bits (56), Expect = 3.5 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = -3 Query: 330 HLLDSLFIESNLCDMNSFKTMQILLRSTLIVNKLI 226 ++L LF N N+F T QIL +S +++N L+ Sbjct: 270 YILKLLFDHLNRKKTNNFNTHQILSQSDVVLNALL 304 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,788,981 Number of Sequences: 5004 Number of extensions: 56787 Number of successful extensions: 125 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 123 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 125 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 329179816 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -