BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10b05r (707 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY062432-1|AAL47188.1| 391|Anopheles gambiae putative odorant r... 23 9.4 AF316638-1|AAG45166.1| 211|Anopheles gambiae glutathione S-tran... 23 9.4 >AY062432-1|AAL47188.1| 391|Anopheles gambiae putative odorant receptor Or5 protein. Length = 391 Score = 23.0 bits (47), Expect = 9.4 Identities = 9/27 (33%), Positives = 17/27 (62%) Frame = +3 Query: 381 LVPTIFNID*IIAIRSITPYCNIKYTS 461 ++PTIF + ++ +T + N+KY S Sbjct: 191 MLPTIFMLAYFGGLKLLTIFSNVKYCS 217 >AF316638-1|AAG45166.1| 211|Anopheles gambiae glutathione S-transferase D12 protein. Length = 211 Score = 23.0 bits (47), Expect = 9.4 Identities = 15/50 (30%), Positives = 23/50 (46%) Frame = +1 Query: 535 HQR*QYDSVLCKERTNETTLIYLSLNVIDDRDLVFTCSPVGLVVRLIFDA 684 HQR +DS + + T + L +L N I D L V +V + D+ Sbjct: 93 HQRLFFDSGMFQNTTLQAVLSHLRNNPITDEHLAKVKRGVEIVEMYLTDS 142 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 683,536 Number of Sequences: 2352 Number of extensions: 12913 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 72340815 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -