BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10b05r (707 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC090999-7|AAK26142.1| 438|Caenorhabditis elegans Hypothetical ... 29 4.3 Z71178-3|CAA94876.2| 254|Caenorhabditis elegans Hypothetical pr... 28 7.5 >AC090999-7|AAK26142.1| 438|Caenorhabditis elegans Hypothetical protein Y82E9BR.12 protein. Length = 438 Score = 28.7 bits (61), Expect = 4.3 Identities = 15/47 (31%), Positives = 24/47 (51%) Frame = +3 Query: 414 IAIRSITPYCNIKYTSYLANDMDQNQIIVSSFTKTISQLETPKVTIR 554 IAI+ + N T +L D D Q +++F KT+ + + V IR Sbjct: 195 IAIKDLETVMNHVSTLFLTIDADAQQGFITTFRKTLKESKCVNVRIR 241 >Z71178-3|CAA94876.2| 254|Caenorhabditis elegans Hypothetical protein B0024.3 protein. Length = 254 Score = 27.9 bits (59), Expect = 7.5 Identities = 16/51 (31%), Positives = 26/51 (50%) Frame = -3 Query: 255 RSTLIVNKLIKPHEPLFMYSLSVQITLLNSLI*FMVSKLATISNFGYFWKS 103 RST+ + H P+F +SL+ N+LI +++ T N Y+W S Sbjct: 84 RSTIFASLYSHAHSPIFSHSLT------NALIISSLARPITYDNRQYYWDS 128 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,825,303 Number of Sequences: 27780 Number of extensions: 297116 Number of successful extensions: 592 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 577 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 592 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1645110168 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -