BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10b03r (734 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF032397-1|ABM97933.1| 200|Apis mellifera arginine kinase protein. 25 0.98 AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. 25 0.98 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 25 0.98 X72577-1|CAA51169.1| 283|Apis mellifera Apidaecin precursor pro... 24 1.7 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 22 5.2 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 21 9.1 >EF032397-1|ABM97933.1| 200|Apis mellifera arginine kinase protein. Length = 200 Score = 24.6 bits (51), Expect = 0.98 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +2 Query: 83 FDHSLIDCLLIGFALLRWNVFLFFCGKDVITLFA 184 FD +L+DC+ G L V ++ + TLFA Sbjct: 29 FDSTLLDCIQSGIENLDSGVGIYAPDAEAYTLFA 62 >AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. Length = 355 Score = 24.6 bits (51), Expect = 0.98 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +2 Query: 83 FDHSLIDCLLIGFALLRWNVFLFFCGKDVITLFA 184 FD +L+DC+ G L V ++ + TLFA Sbjct: 45 FDSTLLDCIQSGIENLDSGVGIYAPDAEAYTLFA 78 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 24.6 bits (51), Expect = 0.98 Identities = 21/91 (23%), Positives = 40/91 (43%), Gaps = 3/91 (3%) Frame = -3 Query: 300 SAM*SAPPPEFHSATSNCQNTSMMITSRRIRSASNVQSNAKRVMTSLPQKKRNTFHLSSA 121 +A+ S PPP F + + + S ++++ R + + +A M +P N ++S Sbjct: 374 TALMSQPPPNFGVSQVSPVSMSALVSAVRSPAGGQLPPSAGAPMPPIP----NMSNMSGM 429 Query: 120 KPIRRQSMRL*SKPLEPD---PTRRCSADTS 37 P+ + + P P P RR +D S Sbjct: 430 PPLPNMPGSMPTMPTMPSMAGPIRRRISDKS 460 >X72577-1|CAA51169.1| 283|Apis mellifera Apidaecin precursor protein. Length = 283 Score = 23.8 bits (49), Expect = 1.7 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = -3 Query: 87 SKPLEPDPTRRCSADTSRRPSDSAPANIP 1 S+P P P R A+ P ++ P IP Sbjct: 106 SQPRPPHPRLRREAEPEAEPGNNRPVYIP 134 Score = 23.8 bits (49), Expect = 1.7 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = -3 Query: 87 SKPLEPDPTRRCSADTSRRPSDSAPANIP 1 S+P P P R A+ P ++ P IP Sbjct: 162 SQPRPPHPRLRREAEPEAEPGNNRPVYIP 190 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 22.2 bits (45), Expect = 5.2 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = -1 Query: 74 SPTRQEGAPRIPQGGLRTPLQPIS 3 +P+RQ G+ GGL TP ++ Sbjct: 1922 APSRQTGSGHGGHGGLLTPYDTVA 1945 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 21.4 bits (43), Expect = 9.1 Identities = 8/26 (30%), Positives = 12/26 (46%) Frame = -1 Query: 521 LPHSGENPCLIWWPSIQQACTQDPTQ 444 +P +NP + W AC+ P Q Sbjct: 373 IPEPSKNPAMGHWQMSCVACSPPPRQ 398 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 208,963 Number of Sequences: 438 Number of extensions: 4384 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22901220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -