BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10b01r (768 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z46934-11|CAE18043.1| 497|Caenorhabditis elegans Hypothetical p... 30 1.6 Z46934-10|CAD18882.1| 495|Caenorhabditis elegans Hypothetical p... 30 1.6 Z81507-1|CAB04133.1| 485|Caenorhabditis elegans Hypothetical pr... 30 2.1 AF036698-2|AAB88353.1| 485|Caenorhabditis elegans Puf (pumilio/... 30 2.1 L12018-1|AAA65458.1| 518|Caenorhabditis elegans Polk (dna polym... 28 8.4 >Z46934-11|CAE18043.1| 497|Caenorhabditis elegans Hypothetical protein ZK1320.12b protein. Length = 497 Score = 30.3 bits (65), Expect = 1.6 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = -3 Query: 718 DYDSAVEKSKHLYEEKKSEVITNVVNKLIRNNKMNCM 608 D D + EK + +KK IT++VN +IRN C+ Sbjct: 205 DIDFSYEKVREAMSQKKRNGITSLVNYMIRNYPSICL 241 >Z46934-10|CAD18882.1| 495|Caenorhabditis elegans Hypothetical protein ZK1320.12a protein. Length = 495 Score = 30.3 bits (65), Expect = 1.6 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = -3 Query: 718 DYDSAVEKSKHLYEEKKSEVITNVVNKLIRNNKMNCM 608 D D + EK + +KK IT++VN +IRN C+ Sbjct: 205 DIDFSYEKVREAMSQKKRNGITSLVNYMIRNYPSICL 241 >Z81507-1|CAB04133.1| 485|Caenorhabditis elegans Hypothetical protein F18A11.1 protein. Length = 485 Score = 29.9 bits (64), Expect = 2.1 Identities = 16/59 (27%), Positives = 30/59 (50%) Frame = -3 Query: 661 VITNVVNKLIRNNKMNCMEYAYQLWLQGSKDIVRDCFPVEFRLIFAENAIKLMYKRDGL 485 ++ V+++L N K+ C ++ QL IVR+C+ + FA I+ + K G+ Sbjct: 257 LVQQVIDRLAENPKLPCFKFRIQLLHSLMTCIVRNCYRLSSN-EFANYVIQYVIKSSGI 314 >AF036698-2|AAB88353.1| 485|Caenorhabditis elegans Puf (pumilio/fbf) domain-containingprotein 7 protein. Length = 485 Score = 29.9 bits (64), Expect = 2.1 Identities = 16/59 (27%), Positives = 30/59 (50%) Frame = -3 Query: 661 VITNVVNKLIRNNKMNCMEYAYQLWLQGSKDIVRDCFPVEFRLIFAENAIKLMYKRDGL 485 ++ V+++L N K+ C ++ QL IVR+C+ + FA I+ + K G+ Sbjct: 257 LVQQVIDRLAENPKLPCFKFRIQLLHSLMTCIVRNCYRLSSN-EFANYVIQYVIKSSGI 314 >L12018-1|AAA65458.1| 518|Caenorhabditis elegans Polk (dna polymerase kappa) homologprotein 1 protein. Length = 518 Score = 27.9 bits (59), Expect = 8.4 Identities = 20/68 (29%), Positives = 31/68 (45%), Gaps = 2/68 (2%) Frame = -3 Query: 721 ADYDSAVEKSKHLYEEKKSEVITNVVNKLIRNN--KMNCMEYAYQLWLQGSKDIVRDCFP 548 A Y S +K + EEK E I N + R K + ++ L+ S+D+ RDC Sbjct: 29 ASYSSFSKKQQSRIEEKVLE-IKNRLQTATREERQKSEILMENLEMKLESSRDLSRDCVC 87 Query: 547 VEFRLIFA 524 ++ FA Sbjct: 88 IDMDAYFA 95 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,188,026 Number of Sequences: 27780 Number of extensions: 328401 Number of successful extensions: 1085 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1012 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1085 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1840614650 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -