BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10b01f (587 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_1511 - 30669292-30669401,30669894-30669930,30670012-306701... 34 0.097 01_01_0866 - 6765761-6766413,6766805-6766906,6767693-6768965 32 0.39 08_02_0647 - 19687142-19687145,19687244-19689352,19689764-19690617 29 2.1 >06_03_1511 - 30669292-30669401,30669894-30669930,30670012-30670107, 30670186-30670281,30670679-30670828,30670956-30671100, 30671178-30671251,30671325-30671445,30671697-30671821, 30671898-30672047,30672249-30672324,30672496-30672557, 30672597-30672839,30673354-30673683,30673776-30673932, 30674008-30674139,30674219-30674277,30674734-30674798, 30674878-30675094,30675413-30675499,30675655-30675750, 30675938-30676003,30676096-30676287,30676380-30676532, 30676812-30677052,30677322-30677515,30678212-30678348, 30678474-30678480,30678708-30678830,30679370-30679427, 30680018-30680090,30680493-30681765 Length = 1714 Score = 33.9 bits (74), Expect = 0.097 Identities = 18/67 (26%), Positives = 35/67 (52%) Frame = -2 Query: 487 NELPADFRACFVLTVAEGKSAIVAVNIITQRQSETVALVHKLNGVFGEDKSELNWETITD 308 NEL ++ F+L V +I +NI+ QR S + V+ N + G+ +++ I + Sbjct: 895 NELKSEELESFLLVVDGANFSIPELNILMQRYSGACSWVNHANNIVGKLLERNDYDNIVE 954 Query: 307 DVLGALE 287 ++ G L+ Sbjct: 955 ELTGILK 961 >01_01_0866 - 6765761-6766413,6766805-6766906,6767693-6768965 Length = 675 Score = 31.9 bits (69), Expect = 0.39 Identities = 19/48 (39%), Positives = 27/48 (56%) Frame = -2 Query: 370 HKLNGVFGEDKSELNWETITDDVLGALEPKLIGVLHAVHLVVSYQFVH 227 ++L G GED++ LNWET LGA G+ H +H + +FVH Sbjct: 455 NELIGKRGEDRTPLNWETRVRIALGAAR----GIAH-IHTENNGKFVH 497 >08_02_0647 - 19687142-19687145,19687244-19689352,19689764-19690617 Length = 988 Score = 29.5 bits (63), Expect = 2.1 Identities = 17/73 (23%), Positives = 37/73 (50%), Gaps = 2/73 (2%) Frame = +2 Query: 113 DILEEQLYNSIVVADY--DSAVEKSKHLYEEKKSEVITNVVNKLIRNNKMNCMEYAYQLW 286 DIL E LY S ++DY D ++L + + + N++ + ++NN+ + +W Sbjct: 237 DILSEVLYTSNPMSDYQKDHFWRIKENLNQPLEDHQLINMIKEYLKNNRYFIV--IDDIW 294 Query: 287 LQGSKDIVRDCFP 325 + + +++ FP Sbjct: 295 SKSAWQVIQCAFP 307 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,394,579 Number of Sequences: 37544 Number of extensions: 271106 Number of successful extensions: 885 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 868 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 885 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1388195172 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -