BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10b01f (587 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g49400.1 68416.m05400 transducin family protein / WD-40 repea... 34 0.061 At1g60170.1 68414.m06778 pre-mRNA processing ribonucleoprotein b... 31 0.75 At5g63450.1 68418.m07965 cytochrome P450, putative 30 1.00 At3g48520.1 68416.m05296 cytochrome P450 family protein similar ... 30 1.3 At4g39510.1 68417.m05587 cytochrome P450 family protein contains... 29 1.7 At5g64820.1 68418.m08155 hypothetical protein 29 3.0 At3g30550.1 68416.m03866 hypothetical protein includes At2g05890... 29 3.0 At1g16280.1 68414.m01949 DEAD/DEAH box helicase, putative simila... 29 3.0 At5g13010.1 68418.m01491 RNA helicase, putative similar to DEAH-... 28 4.0 At5g03800.1 68418.m00347 exostosin family protein / pentatricope... 28 4.0 At5g16590.1 68418.m01942 leucine-rich repeat transmembrane prote... 28 5.3 At2g04620.1 68415.m00470 cation efflux family protein potential ... 28 5.3 At1g06550.1 68414.m00694 enoyl-CoA hydratase/isomerase family pr... 28 5.3 At5g07400.1 68418.m00847 forkhead-associated domain-containing p... 27 7.0 At4g28590.1 68417.m04089 expressed protein 27 7.0 At5g19100.1 68418.m02272 extracellular dermal glycoprotein-relat... 27 9.3 At1g76730.1 68414.m08930 5-formyltetrahydrofolate cyclo-ligase f... 27 9.3 At1g59453.1 68414.m06679 transcription factor-related weak simil... 27 9.3 At1g59077.1 68414.m06670 hypothetical protein 27 9.3 At1g58766.1 68414.m06659 hypothetical protein 27 9.3 At1g20410.1 68414.m02545 expressed protein 27 9.3 At1g04120.1 68414.m00401 ABC transporter family protein Strong s... 27 9.3 >At3g49400.1 68416.m05400 transducin family protein / WD-40 repeat family protein contains 4 WD-40 repeats (PF00400); low similarity (47%) to Agamous-like MADS box protein AGL5 (SP:P29385) {Arabidopsis thaliana} Length = 892 Score = 34.3 bits (75), Expect = 0.061 Identities = 22/76 (28%), Positives = 38/76 (50%), Gaps = 8/76 (10%) Frame = -2 Query: 499 LPQSNELPADFRACFVLTVAEGKSAIVAV--------NIITQRQSETVALVHKLNGVFGE 344 L + +LP DF +C + ++ G A+ V N + Q +S+ A+ NG Sbjct: 482 LSSTTDLPDDFLSCLGVALSPGNLAVALVRNFNVELLNPMYQARSQKAAVEFLWNGAQQS 541 Query: 343 DKSELNWETITDDVLG 296 +SE + ET+T+ +LG Sbjct: 542 GESEDSTETVTEAILG 557 >At1g60170.1 68414.m06778 pre-mRNA processing ribonucleoprotein binding region-containing protein similar to U4/U6 snRNP-associated 61 kDa protein [Homo sapiens] GI:18249847; contains Pfam profile PF01798: Putative snoRNA binding domain Length = 485 Score = 30.7 bits (66), Expect = 0.75 Identities = 17/60 (28%), Positives = 28/60 (46%) Frame = +2 Query: 47 PVIVILCLFVASLYAADSDVPNDILEEQLYNSIVVADYDSAVEKSKHLYEEKKSEVITNV 226 P +I+ + V +L S +P D+L++ L D DSA +K E K + N+ Sbjct: 161 PSAIIMVVSVTALTTKGSALPEDVLQKVLEACDRALDLDSARKKVLEFVESKMGSIAPNL 220 >At5g63450.1 68418.m07965 cytochrome P450, putative Length = 510 Score = 30.3 bits (65), Expect = 1.00 Identities = 17/40 (42%), Positives = 25/40 (62%) Frame = +2 Query: 446 GKDKTSPKVSWKFIALWENNKVYFKILNTERNQYLVLGVG 565 G+D TS ++W F L +N+ V KIL+ RN+ LG+G Sbjct: 306 GRDTTSAAMTWLFWLLSQNDDVETKILDELRNKG-SLGLG 344 >At3g48520.1 68416.m05296 cytochrome P450 family protein similar to Cytochrome P450 94A1 (P450-dependent fatty acid omega-hydroxylase) (SP:O81117) {Vicia sativa}; contains Pfam profile: PF00067 cytochrome P450 Length = 506 Score = 29.9 bits (64), Expect = 1.3 Identities = 17/40 (42%), Positives = 24/40 (60%) Frame = +2 Query: 446 GKDKTSPKVSWKFIALWENNKVYFKILNTERNQYLVLGVG 565 G+D TS ++W F L EN+ V KIL E + + LG+G Sbjct: 304 GRDTTSAAMTWLFWLLTENDDVERKILE-EVDPLVSLGLG 342 >At4g39510.1 68417.m05587 cytochrome P450 family protein contains Pfam PF00067: Cytochrome P450; similar to Cytochrome P450 86A2 (SP:O23066) [Arabidopsis thaliana] Length = 508 Score = 29.5 bits (63), Expect = 1.7 Identities = 20/45 (44%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = +2 Query: 392 LTLSNDVHGNDGRLAFG-DGKDKTSPKVSWKFIALWENNKVYFKI 523 L S+D D LAF G+D TS +SW F L EN +V KI Sbjct: 293 LNPSDDKFLRDTILAFNLAGRDTTSSALSWFFWLLSENPQVVTKI 337 >At5g64820.1 68418.m08155 hypothetical protein Length = 145 Score = 28.7 bits (61), Expect = 3.0 Identities = 13/49 (26%), Positives = 25/49 (51%) Frame = -2 Query: 460 CFVLTVAEGKSAIVAVNIITQRQSETVALVHKLNGVFGEDKSELNWETI 314 C ++ + G SA A + ++ E ++V ++G+FG +WE I Sbjct: 15 CIIIILISGVSADGAESDSAAKKEENPSIVKIISGIFGNKFPPSSWELI 63 >At3g30550.1 68416.m03866 hypothetical protein includes At2g05890, At4g07450, At3g30630, At3g43100, At2g09960, At3g30550, At1g39430, At2g10460, At4g03640, At5g35250 Length = 509 Score = 28.7 bits (61), Expect = 3.0 Identities = 19/69 (27%), Positives = 35/69 (50%), Gaps = 1/69 (1%) Frame = +2 Query: 29 NAPKMKPVIVILCLFVASLYAA-DSDVPNDILEEQLYNSIVVADYDSAVEKSKHLYEEKK 205 N K K +LC+ +++ DS + + + + IV DYD+ V+ S + E+ Sbjct: 395 NCLKGKTFQFLLCVQRENIFGGYDSFTVARVYTDNIADEIVQEDYDAYVDPSSLISIEQD 454 Query: 206 SEVITNVVN 232 S ++TN V+ Sbjct: 455 SLMLTNGVD 463 >At1g16280.1 68414.m01949 DEAD/DEAH box helicase, putative similar to gb|L13612 DEAD-box protein (dbp45A) from Drosophila melanogaster and is a member of PF|00270 DEAD/DEAH box helicase family Length = 491 Score = 28.7 bits (61), Expect = 3.0 Identities = 22/71 (30%), Positives = 33/71 (46%) Frame = -2 Query: 514 VDLVVLPQSNELPADFRACFVLTVAEGKSAIVAVNIITQRQSETVALVHKLNGVFGEDKS 335 VDLV+ P D+ T G+ + AV+IIT+ V L+HK+ G+ Sbjct: 371 VDLVINYDIPRDPRDYVHRVGRTARAGRGGL-AVSIITETD---VKLIHKIEEEVGKKME 426 Query: 334 ELNWETITDDV 302 N + ITD + Sbjct: 427 PYNKKVITDSL 437 >At5g13010.1 68418.m01491 RNA helicase, putative similar to DEAH-box RNA helicase [Chlamydomonas reinhardtii] GI:12044832; contains Pfam profiles PF04408: Helicase associated domain (HA2), PF00271: Helicase conserved C-terminal domain Length = 1226 Score = 28.3 bits (60), Expect = 4.0 Identities = 19/61 (31%), Positives = 34/61 (55%), Gaps = 1/61 (1%) Frame = -2 Query: 586 VVAVRVSTDSQYQILVTLSVQDLEVDLVVLPQSNELPADFRACFVLTVAEG-KSAIVAVN 410 + A S + + LV+ S +++ +L++LP ++LPAD +A +G + IVA N Sbjct: 750 IEAACFSLKERMEQLVSSSSREI-TNLLILPIYSQLPADLQAKIFQKPEDGARKCIVATN 808 Query: 409 I 407 I Sbjct: 809 I 809 >At5g03800.1 68418.m00347 exostosin family protein / pentatricopeptide (PPR) repeat-containing protein contains Pfam profiles: PF03016 exostosin family, PF01535 PPR repeat Length = 1388 Score = 28.3 bits (60), Expect = 4.0 Identities = 13/34 (38%), Positives = 22/34 (64%) Frame = -3 Query: 558 PNTKYWLRSVFKILK*TLLFSHRAMNFQLTFGLV 457 PNT+Y L+ V + +K + LF H A +T+G++ Sbjct: 806 PNTEYVLQEVDEFMKKSFLFHHSA-KLAVTYGIL 838 >At5g16590.1 68418.m01942 leucine-rich repeat transmembrane protein kinase, putative Length = 625 Score = 27.9 bits (59), Expect = 5.3 Identities = 16/42 (38%), Positives = 22/42 (52%) Frame = -2 Query: 364 LNGVFGEDKSELNWETITDDVLGALEPKLIGVLHAVHLVVSY 239 L+G G +S LNWET + LGA + I LH+ S+ Sbjct: 427 LHGNKGSGRSPLNWETRANIALGA--ARAISYLHSRDATTSH 466 >At2g04620.1 68415.m00470 cation efflux family protein potential member of the cation diffusion facilitator (CDF) family, or cation efflux (CE) family, see PMID:11500563 Length = 798 Score = 27.9 bits (59), Expect = 5.3 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = -2 Query: 136 VKLLLQNVVRDVGICSIQRCHEKT*NNYD 50 +K ++N+++ G+CSIQR H + N D Sbjct: 727 LKEAMRNILKTKGVCSIQRLHVWSFTNSD 755 >At1g06550.1 68414.m00694 enoyl-CoA hydratase/isomerase family protein similar to CHY1 [gi:8572760]; contains Pfam profile PF00388 enoyl-CoA hydratase/isomerase family protein Length = 387 Score = 27.9 bits (59), Expect = 5.3 Identities = 32/118 (27%), Positives = 55/118 (46%), Gaps = 4/118 (3%) Frame = +2 Query: 206 SEVITNVVNKLIRNNKMNCMEYAYQLWLQGSKDIVRDCFPVEFRL---IFAENAIKLMYK 376 +E IT V+ L R++ ++ Q +G K + DC EFRL I + MY Sbjct: 263 NEWITPVIKGLKRSSPTG-LKIVLQSIREGRKQTLSDCLKKEFRLTLNILRKTISPDMY- 320 Query: 377 RDGL-ALTLSNDVHGNDGRLAFGDGKDKTSPKVSWKFIALWENNKVYFKILNTERNQY 547 +G+ ALT+ D + D+ K++ F L+E++ + +I TE N++ Sbjct: 321 -EGIRALTIDKDNSPKWNPATLDEVDDE---KINSVF-KLFEDDDIELQIPETEENRW 373 >At5g07400.1 68418.m00847 forkhead-associated domain-containing protein / FHA domain-containing protein Length = 1084 Score = 27.5 bits (58), Expect = 7.0 Identities = 24/80 (30%), Positives = 39/80 (48%), Gaps = 2/80 (2%) Frame = -2 Query: 472 DFRACFVLT--VAEGKSAIVAVNIITQRQSETVALVHKLNGVFGEDKSELNWETITDDVL 299 D R FV+ V EG+ A + V++ + T + + VF ++E+N V Sbjct: 153 DGRVGFVVQEIVFEGRDASI-VSVSSGHSRGTFSSGKRSKRVFAPMENEIN-----SPVS 206 Query: 298 GALEPKLIGVLHAVHLVVSY 239 G PK +GV+ V+ +VSY Sbjct: 207 GFYPPKAVGVVERVNSLVSY 226 >At4g28590.1 68417.m04089 expressed protein Length = 331 Score = 27.5 bits (58), Expect = 7.0 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 370 HKLNGVFGEDKSELNWETITDD 305 H + V G+D SE++WE DD Sbjct: 180 HPIKNVVGDDGSEIDWEGEIDD 201 >At5g19100.1 68418.m02272 extracellular dermal glycoprotein-related / EDGP-related low similarity to extracellular dermal glycoprotein EDGP precursor [Daucus carota] GI:285741, SP|P13917 Basic 7S globulin precursor {Glycine max} Length = 391 Score = 27.1 bits (57), Expect = 9.3 Identities = 17/54 (31%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Frame = -2 Query: 388 ETVALVHKLNGVFGEDKSELNWETIT-DDVLGALEPKLIGVLHAVHLVVSYQFV 230 +TV L++ NGV+ D + T+T D AL+ + IG+ + HL + Q + Sbjct: 122 DTVPLLYTFNGVYTRDSEMSSSLTLTCTDGAPALKQRTIGLAN-THLSIPSQLI 174 >At1g76730.1 68414.m08930 5-formyltetrahydrofolate cyclo-ligase family protein contains Pfam profile PF01812 5-formyltetrahydrofolate cyclo-ligase Length = 354 Score = 27.1 bits (57), Expect = 9.3 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +3 Query: 297 PRTSSVIVSQLSSDLSSPKTPLSLCTSATVS 389 PR + S L SDL P+T + CTS V+ Sbjct: 171 PRLRTGFFSVLESDLLKPETIMEACTSVGVA 201 >At1g59453.1 68414.m06679 transcription factor-related weak similarity to TFIIIC Box B-binding subunit [Homo sapiens] GI:442362 Length = 1729 Score = 27.1 bits (57), Expect = 9.3 Identities = 13/37 (35%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +2 Query: 119 LEEQLYNSIVVADYDSAVEKSKHLYEEKKSEV-ITNV 226 LEE N +V +DY ++ +K H+ E +V I N+ Sbjct: 1545 LEEHRSNDVVTSDYSTSKDKQVHVSENSVHKVTILNI 1581 >At1g59077.1 68414.m06670 hypothetical protein Length = 665 Score = 27.1 bits (57), Expect = 9.3 Identities = 13/37 (35%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +2 Query: 119 LEEQLYNSIVVADYDSAVEKSKHLYEEKKSEV-ITNV 226 LEE N +V +DY ++ +K H+ E +V I N+ Sbjct: 481 LEEHRSNDVVTSDYSTSKDKQVHVSENSVHKVTILNI 517 >At1g58766.1 68414.m06659 hypothetical protein Length = 665 Score = 27.1 bits (57), Expect = 9.3 Identities = 13/37 (35%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +2 Query: 119 LEEQLYNSIVVADYDSAVEKSKHLYEEKKSEV-ITNV 226 LEE N +V +DY ++ +K H+ E +V I N+ Sbjct: 481 LEEHRSNDVVTSDYSTSKDKQVHVSENSVHKVTILNI 517 >At1g20410.1 68414.m02545 expressed protein Length = 504 Score = 27.1 bits (57), Expect = 9.3 Identities = 25/96 (26%), Positives = 47/96 (48%), Gaps = 4/96 (4%) Frame = +2 Query: 53 IVILCLFVASLYAADSDVPNDILEEQLYNSIVVADYDSAVEKSKHLYEEKKSEVITNVVN 232 I I+CL + L SDV ++++ +S VA V++ +H ++ EV +V + Sbjct: 97 ICIVCLGI--LQFVFSDVKKELVKSDS-SSDYVARITDLVKQDRHEFDSFGLEV--SVPS 151 Query: 233 KLIRNNKMNCM----EYAYQLWLQGSKDIVRDCFPV 328 ++ N + +Y+ ++WLQ K V+D V Sbjct: 152 TIMENERALLSYLKGKYSTEVWLQRDKISVKDALKV 187 >At1g04120.1 68414.m00401 ABC transporter family protein Strong similarity to MRP-like ABC transporter gb|U92650 from A. thaliana and canalicular multi-drug resistance protein gb|L49379 from Rattus norvegicus Length = 1514 Score = 27.1 bits (57), Expect = 9.3 Identities = 8/32 (25%), Positives = 18/32 (56%) Frame = +3 Query: 72 SWHLCMLQIPTSLTTFWRSSFTIASSLPITTV 167 +W + +L +P ++ FW + +ASS + + Sbjct: 1086 TWQVFLLVVPVAVACFWMQKYYMASSRELVRI 1117 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,640,980 Number of Sequences: 28952 Number of extensions: 221320 Number of successful extensions: 889 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 866 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 889 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1161268208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -