BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10a24r (727 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 23 2.2 AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. 23 2.2 AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase ... 22 6.8 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 23.4 bits (48), Expect = 2.2 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = +3 Query: 333 MKIISHQNAKLSWNILNLTCTNTQ 404 M+ IS +NAK+S + + TC+N+Q Sbjct: 2 MEEISTENAKVSDSGYSNTCSNSQ 25 >AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. Length = 289 Score = 23.4 bits (48), Expect = 2.2 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = +3 Query: 333 MKIISHQNAKLSWNILNLTCTNTQ 404 M+ IS +NAK+S + + TC+N+Q Sbjct: 2 MEEISTENAKVSDSGYSNTCSNSQ 25 >AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase protein. Length = 510 Score = 21.8 bits (44), Expect = 6.8 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +1 Query: 145 TKCFFFLFNKIYIHRCVEET*NFKRAETCKI 237 T+ F L + + H C E NFK+ + KI Sbjct: 241 TRVFNTLVDLVPKHACAEYRRNFKKMQEEKI 271 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 180,802 Number of Sequences: 438 Number of extensions: 3766 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22535775 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -