BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10a21r (533 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g23530.1 68415.m02808 expressed protein ; expression supporte... 32 0.28 At1g04790.1 68414.m00475 zinc finger (C3HC4-type RING finger) fa... 32 0.28 At1g25510.1 68414.m03168 aspartyl protease family protein contai... 29 2.6 At1g56020.1 68414.m06431 expressed protein 28 3.4 At3g20015.1 68416.m02532 aspartyl protease family protein contai... 28 4.5 At1g53730.1 68414.m06114 leucine-rich repeat transmembrane prote... 27 5.9 >At2g23530.1 68415.m02808 expressed protein ; expression supported by MPSS Length = 555 Score = 31.9 bits (69), Expect = 0.28 Identities = 17/41 (41%), Positives = 23/41 (56%) Frame = +1 Query: 355 NKLET*SRTRLAVIVGARVTRGAESAASPPEPRSLVGRVRR 477 + LET ++V ARVTR AA P P S+ GR+R+ Sbjct: 511 SNLETRLGESQTLVVKARVTRSKRKAALEPNPDSIGGRLRQ 551 >At1g04790.1 68414.m00475 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 634 Score = 31.9 bits (69), Expect = 0.28 Identities = 22/85 (25%), Positives = 37/85 (43%) Frame = -1 Query: 500 AKVNLSCPRRTLPTSERGSGGDAADSAPRVTRAPTITASRVRDHVSSLLVIFYVSVRSVQ 321 A V + RRT+ ++G APRV + P + ++ HV + Y ++ Sbjct: 76 ASVGNALFRRTVVEKDKGKSISTDPCAPRVEKNPVLNLNQRNGHV-HVAASRYQPSEDIR 134 Query: 320 VMRTTNNTSMILRSFKSYNLLFNYN 246 +RT+N S + S+ L N N Sbjct: 135 ELRTSNGCSPLRGDHNSFVLPGNSN 159 >At1g25510.1 68414.m03168 aspartyl protease family protein contains Pfam domain, PF00026: eukaryotic aspartyl protease Length = 483 Score = 28.7 bits (61), Expect = 2.6 Identities = 15/39 (38%), Positives = 19/39 (48%) Frame = -1 Query: 488 LSCPRRTLPTSERGSGGDAADSAPRVTRAPTITASRVRD 372 L P+ + E GSGG DS VTR T + +RD Sbjct: 343 LQIPQSSFEMDESGSGGIIIDSGTAVTRLQTEIYNSLRD 381 >At1g56020.1 68414.m06431 expressed protein Length = 398 Score = 28.3 bits (60), Expect = 3.4 Identities = 16/49 (32%), Positives = 25/49 (51%) Frame = -1 Query: 497 KVNLSCPRRTLPTSERGSGGDAADSAPRVTRAPTITASRVRDHVSSLLV 351 ++ L+ PRR P S G ++ SA +R T+TA R + S +V Sbjct: 251 RIRLAKPRRNHPPSTPSVDGSSSSSACIESRGLTVTADSPRLNASGKIV 299 >At3g20015.1 68416.m02532 aspartyl protease family protein contains Pfam domain, PF00026: eukaryotic aspartyl protease Length = 386 Score = 27.9 bits (59), Expect = 4.5 Identities = 15/45 (33%), Positives = 18/45 (40%) Frame = -1 Query: 494 VNLSCPRRTLPTSERGSGGDAADSAPRVTRAPTITASRVRDHVSS 360 V + P +E G GG D+ VTR PT RD S Sbjct: 244 VRIPLPDGVFDLTETGDGGVVMDTGTAVTRLPTAAYVAFRDGFKS 288 >At1g53730.1 68414.m06114 leucine-rich repeat transmembrane protein kinase, putative similar to GI:3360289 from [Zea mays] (Plant Mol. Biol. 37 (5), 749-761 (1998)) Length = 719 Score = 27.5 bits (58), Expect = 5.9 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -2 Query: 514 PRPPEPKSTSPARGAPCR 461 P PP P T P RG+P R Sbjct: 248 PAPPPPPGTPPIRGSPSR 265 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,546,386 Number of Sequences: 28952 Number of extensions: 134438 Number of successful extensions: 325 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 311 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 324 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 984125600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -