BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10a21f (575 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_57823| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.67 SB_37499| Best HMM Match : 7tm_1 (HMM E-Value=4e-09) 30 1.2 SB_5806| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 >SB_57823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 614 Score = 31.1 bits (67), Expect = 0.67 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = +1 Query: 43 NLSCPRRTLP-TSERGSGGDAADSAPRVTRAPTITAS 150 N CP RT+P T + + D +AP + + PT AS Sbjct: 385 NYDCPPRTVPSTGDAPANNDPVSNAPMMNKGPTSDAS 421 >SB_37499| Best HMM Match : 7tm_1 (HMM E-Value=4e-09) Length = 378 Score = 30.3 bits (65), Expect = 1.2 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = +1 Query: 91 GGDAADSAPRVTRAPTITASRVRDHVSSLLVIFYVS 198 GGD AD APR R + + +L+V FYVS Sbjct: 267 GGDGADRAPRGVRPGPRRDGKFTSAILTLIVCFYVS 302 >SB_5806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 418 Score = 29.1 bits (62), Expect = 2.7 Identities = 15/49 (30%), Positives = 23/49 (46%) Frame = +1 Query: 124 TRAPTITASRVRDHVSSLLVIFYVSVRSVQVMRTTNNTSMILRSFKSYN 270 T P A HV + R + ++R T NT++I R FK++N Sbjct: 113 TNHPDRIACSGVSHVGISYHSLVYAYRKLSIVRLTKNTTIIYRKFKNFN 161 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,578,119 Number of Sequences: 59808 Number of extensions: 217597 Number of successful extensions: 504 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 472 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 504 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1373676929 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -