BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10a20f (641 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z83217-5|CAB05684.2| 1565|Caenorhabditis elegans Hypothetical pr... 28 6.5 AM086627-1|CAJ31105.1| 1565|Caenorhabditis elegans KIN-4 protein... 28 6.5 >Z83217-5|CAB05684.2| 1565|Caenorhabditis elegans Hypothetical protein C10C6.1 protein. Length = 1565 Score = 27.9 bits (59), Expect = 6.5 Identities = 13/43 (30%), Positives = 22/43 (51%) Frame = +2 Query: 194 TFKTIERDIKKQSDIIIAFIHWNLTRRGFRSIGLSDERTITGD 322 ++ + RD+K + +I A H LT G IGL + T+ + Sbjct: 669 SYGIVHRDLKPDNLLITAMGHIKLTDFGLSKIGLMNRTTLVAE 711 >AM086627-1|CAJ31105.1| 1565|Caenorhabditis elegans KIN-4 protein protein. Length = 1565 Score = 27.9 bits (59), Expect = 6.5 Identities = 13/43 (30%), Positives = 22/43 (51%) Frame = +2 Query: 194 TFKTIERDIKKQSDIIIAFIHWNLTRRGFRSIGLSDERTITGD 322 ++ + RD+K + +I A H LT G IGL + T+ + Sbjct: 669 SYGIVHRDLKPDNLLITAMGHIKLTDFGLSKIGLMNRTTLVAE 711 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,139,870 Number of Sequences: 27780 Number of extensions: 291049 Number of successful extensions: 703 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 690 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 702 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1427403330 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -