BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10a20f (641 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase pro... 23 2.5 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 21 7.7 >AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase protein. Length = 588 Score = 23.0 bits (47), Expect = 2.5 Identities = 11/31 (35%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = +2 Query: 284 SIGLSDERTITGDEPKSELLPEGWND-TENY 373 S+ S T+T D+P++ L + W D +NY Sbjct: 255 SLHASLNHTLTKDQPETYELVKEWRDFVDNY 285 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 21.4 bits (43), Expect = 7.7 Identities = 7/20 (35%), Positives = 15/20 (75%) Frame = -3 Query: 483 MFVTARSSDLIKFTIKFPSV 424 +FV +S+L++ ++ FPS+ Sbjct: 403 LFVETSASELVESSVLFPSL 422 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 172,491 Number of Sequences: 438 Number of extensions: 3636 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19315974 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -