BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10a19r (764 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF236124-1|AAF68382.1| 107|Anopheles gambiae thioredoxin 1 prot... 49 1e-07 DQ974162-1|ABJ52802.1| 418|Anopheles gambiae serpin 3 protein. 25 3.4 AY347952-1|AAR28375.1| 634|Anopheles gambiae putative sulfakini... 25 3.4 >AF236124-1|AAF68382.1| 107|Anopheles gambiae thioredoxin 1 protein. Length = 107 Score = 49.2 bits (112), Expect = 1e-07 Identities = 31/101 (30%), Positives = 46/101 (45%), Gaps = 2/101 (1%) Frame = -1 Query: 644 EDFNNFIRSPA--LGVVHFSAEWAEQCKQVTDVLEELLKLPEIQSSKTQCAVCDAEALSE 471 EDFNN + + L VV F A W CK + LEE + K D + E Sbjct: 9 EDFNNKLEAAGDQLVVVDFFATWCGPCKVIAPKLEEFQNK---YADKIVVVKVDVDECEE 65 Query: 470 VSLQYKVDSVPTVILFKNGTQVDRIDGADAAQISTKIKAQS 348 ++ QY + S+PT + K V + GA+A ++ I+ S Sbjct: 66 LAAQYNIASMPTFLFIKRKEVVGQFSGANAEKLENFIQQHS 106 >DQ974162-1|ABJ52802.1| 418|Anopheles gambiae serpin 3 protein. Length = 418 Score = 24.6 bits (51), Expect = 3.4 Identities = 16/49 (32%), Positives = 24/49 (48%) Frame = -1 Query: 383 AAQISTKIKAQSLNKSPAEITPQKLEDRLKALINKHNIMVFMKGNKETP 237 AA+I+ I + K + I P L+D L LIN ++ KG+ P Sbjct: 164 AAEINAWIAQNTRGKIQSIIKPDLLQDALMMLIN----TIYFKGSWSIP 208 >AY347952-1|AAR28375.1| 634|Anopheles gambiae putative sulfakinin GPCR protein. Length = 634 Score = 24.6 bits (51), Expect = 3.4 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -2 Query: 751 IQSCCNPVALIYCLQN 704 I SCCNP+ YC N Sbjct: 514 ISSCCNPIT--YCFMN 527 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 760,844 Number of Sequences: 2352 Number of extensions: 14240 Number of successful extensions: 23 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79418373 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -