BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10a18f (575 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_47363| Best HMM Match : No HMM Matches (HMM E-Value=.) 171 3e-43 SB_2591| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_50457| Best HMM Match : Amidase (HMM E-Value=2.6e-36) 35 0.055 SB_228| Best HMM Match : SAM_1 (HMM E-Value=10) 33 0.17 SB_35353| Best HMM Match : Arm (HMM E-Value=6.6e-27) 32 0.39 SB_56934| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.89 SB_10198| Best HMM Match : MBT (HMM E-Value=0) 29 3.6 SB_3614| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_45788| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 >SB_47363| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 171 bits (416), Expect = 3e-43 Identities = 79/97 (81%), Positives = 90/97 (92%) Frame = +1 Query: 181 KLQEPILLLGKEKFSMVDIRVTVKGGGHVAQVYAIRQAISKALIAFYQKYVDEASKKEIK 360 K++EPILLLGKE+F VDIRV VKGGGH +++YAIRQAISK+L+A+YQKYVDE SKKEI+ Sbjct: 11 KVEEPILLLGKERFEGVDIRVRVKGGGHTSRIYAIRQAISKSLVAYYQKYVDEVSKKEIR 70 Query: 361 DILVQYDRSLLVADPRRCEPKKFGGPGARARYQKSYR 471 DILVQYDRSLLVADPRR E KKFGGPGAR+RYQKSYR Sbjct: 71 DILVQYDRSLLVADPRRTEAKKFGGPGARSRYQKSYR 107 >SB_2591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 533 Score = 42.3 bits (95), Expect = 3e-04 Identities = 34/99 (34%), Positives = 48/99 (48%) Frame = +1 Query: 73 GRKKTATAVAYCKRGHGMLRVNGRPLDLVEPRLLQYKLQEPILLLGKEKFSMVDIRVTVK 252 G +K + A A+ +G G + VN RP RL Q K Q + D V Sbjct: 338 GYRKRSVAKAWVMKGSGKITVNDRPFVEYFSRL-QDKQQILFPFQVVDCVGQFDASCHVL 396 Query: 253 GGGHVAQVYAIRQAISKALIAFYQKYVDEASKKEIKDIL 369 GGG Q AIR AIS+AL+ F + ++ E ++EI + L Sbjct: 397 GGGLTGQAGAIRLAISRALLNFSEDHL-EPLQEEIPESL 434 >SB_50457| Best HMM Match : Amidase (HMM E-Value=2.6e-36) Length = 391 Score = 34.7 bits (76), Expect = 0.055 Identities = 29/80 (36%), Positives = 37/80 (46%) Frame = +1 Query: 232 DIRVTVKGGGHVAQVYAIRQAISKALIAFYQKYVDEASKKEIKDILVQYDRSLLVADPRR 411 DI+V V GGG Q AI+ I++ALI F ++K L + + D R Sbjct: 323 DIKVNVHGGGESGQAGAIKHGITRALIDF---------NADLKPTLSK--AGFVTRDARE 371 Query: 412 CEPKKFGGPGARARYQKSYR 471 E KK G AR R Q S R Sbjct: 372 VERKKCGLRKARRRKQFSKR 391 >SB_228| Best HMM Match : SAM_1 (HMM E-Value=10) Length = 119 Score = 33.1 bits (72), Expect = 0.17 Identities = 14/37 (37%), Positives = 23/37 (62%) Frame = +1 Query: 307 LIAFYQKYVDEASKKEIKDILVQYDRSLLVADPRRCE 417 ++AF QKY+D +KE +Q+ + +LV+ R CE Sbjct: 53 VLAFRQKYLDNFGRKETSKRFLQFAQGVLVSLARECE 89 >SB_35353| Best HMM Match : Arm (HMM E-Value=6.6e-27) Length = 513 Score = 31.9 bits (69), Expect = 0.39 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 1/27 (3%) Frame = +3 Query: 258 WSCSTSLRYQTSYFK-GSDRLLPEICR 335 WSCSTS+R +TS FK GS LL + R Sbjct: 155 WSCSTSMRNRTSIFKAGSVPLLARLIR 181 >SB_56934| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2541 Score = 30.7 bits (66), Expect = 0.89 Identities = 21/61 (34%), Positives = 35/61 (57%), Gaps = 3/61 (4%) Frame = +1 Query: 250 KGGGHVAQ--VYAIRQAISKALIAFYQKYV-DEASKKEIKDILVQYDRSLLVADPRRCEP 420 K GGH++Q + I Q K L A + K + DE K++ K+I V+ +RS + ++ EP Sbjct: 91 KLGGHLSQPKLKKITQVNKKKLRATHHKAILDEIMKEKAKEIDVKKERSTISRRGKKREP 150 Query: 421 K 423 + Sbjct: 151 E 151 >SB_10198| Best HMM Match : MBT (HMM E-Value=0) Length = 753 Score = 28.7 bits (61), Expect = 3.6 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +2 Query: 2 LFSLSKWLLCRRQDVSPS 55 +FSLSK LC+R D+SPS Sbjct: 611 VFSLSKVALCKRCDISPS 628 >SB_3614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 28.3 bits (60), Expect = 4.8 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 2/31 (6%) Frame = -3 Query: 225 REFFLAEQKDRFLKFVLQQSGLNQ--VQWAP 139 R F + KDR+LK L++ G Q QW P Sbjct: 12 RSFLFTQDKDRYLKAGLKKYGYGQWTAQWVP 42 >SB_45788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 27.5 bits (58), Expect = 8.3 Identities = 13/38 (34%), Positives = 18/38 (47%) Frame = +3 Query: 117 SWNAACKRAPIGLG*AQTAAVQTSGTYPFARQGKILYG 230 SW A K+ P G G ++ +G Y R G+ YG Sbjct: 19 SWQNAEKKKPAGFGRGRSKRGYVNGNYEARRPGERSYG 56 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,267,495 Number of Sequences: 59808 Number of extensions: 399435 Number of successful extensions: 1146 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1076 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1146 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1373676929 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -