BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10a16r (768 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC977.17 |||MIP water channel|Schizosaccharomyces pombe|chr 1|... 28 1.7 SPAC4F10.12 |fta1|sma1|Sim4 and Mal2 associated |Schizosaccharom... 27 3.0 SPAC630.05 |gyp7||GTPase activating protein Gyp7 |Schizosaccharo... 27 3.9 >SPAC977.17 |||MIP water channel|Schizosaccharomyces pombe|chr 1|||Manual Length = 598 Score = 27.9 bits (59), Expect = 1.7 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 1/39 (2%) Frame = -2 Query: 488 VMESEMMPSG-DGQTMVKDWWCKSRNGFPQRLMLPLGTI 375 ++ E + SG D +T+ ++WCK R+ F + LGT+ Sbjct: 283 IIAEESLDSGSDTETLYLNYWCKIRHFFREGFAEFLGTL 321 >SPAC4F10.12 |fta1|sma1|Sim4 and Mal2 associated |Schizosaccharomyces pombe|chr 1|||Manual Length = 280 Score = 27.1 bits (57), Expect = 3.0 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 2/56 (3%) Frame = -2 Query: 215 DMASFFTNNMKFADVMIYRKDL-GMSNTSKTVDTSEMVMMKDDLTY-LDSDMLVKR 54 D +FTN+ +FAD++I + NTS S +K D++Y SD+ VKR Sbjct: 45 DRTGYFTNSTRFADLIIEKATFTEFGNTS-----SFPKFLKLDISYETSSDLEVKR 95 >SPAC630.05 |gyp7||GTPase activating protein Gyp7 |Schizosaccharomyces pombe|chr 1|||Manual Length = 743 Score = 26.6 bits (56), Expect = 3.9 Identities = 16/50 (32%), Positives = 22/50 (44%), Gaps = 3/50 (6%) Frame = -1 Query: 474 NDAFRRWPDNGQGLVVQVSQR---IPSETYAAPRYDWRFGDADVRHRVAG 334 N + R W + Q L S R I S + PRY W +G + R +G Sbjct: 100 NGSIREWVEIPQHLDYSFSVRLCSIYSIIFRPPRYGWNYGSIVINLRDSG 149 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,140,762 Number of Sequences: 5004 Number of extensions: 67743 Number of successful extensions: 214 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 205 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 214 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 369323696 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -