Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fner10a15f
         (626 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM269505-4|CAK30051.1|   23|Tribolium castaneum mlpt peptide 4 p...    22   4.8  
AM292382-1|CAL23194.2|  670|Tribolium castaneum gustatory recept...    21   6.4  
DQ342040-1|ABC69932.1|  822|Tribolium castaneum STIP protein.          21   8.4  

>AM269505-4|CAK30051.1|   23|Tribolium castaneum mlpt peptide 4
           protein.
          Length = 23

 Score = 21.8 bits (44), Expect = 4.8
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = +2

Query: 221 GGRDEGSDGNRRR 259
           GGR E S G RRR
Sbjct: 9   GGRPETSSGRRRR 21


>AM292382-1|CAL23194.2|  670|Tribolium castaneum gustatory receptor
           candidate 61 protein.
          Length = 670

 Score = 21.4 bits (43), Expect = 6.4
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = +2

Query: 317 PTVIMACHFLN 349
           P VI+ACH L+
Sbjct: 169 PNVILACHMLS 179


>DQ342040-1|ABC69932.1|  822|Tribolium castaneum STIP protein.
          Length = 822

 Score = 21.0 bits (42), Expect = 8.4
 Identities = 10/34 (29%), Positives = 21/34 (61%)
 Frame = +3

Query: 375 RKQQMAKEYRVKVEKELREICYDVLGLLDKHLIP 476
           R++Q   + +V+ E ++ +   DV+ ++DK L P
Sbjct: 350 RQEQETLKSQVQRESDVVDSLKDVIEIVDKLLNP 383


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 145,069
Number of Sequences: 336
Number of extensions: 2815
Number of successful extensions: 4
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 122,585
effective HSP length: 54
effective length of database: 104,441
effective search space used: 16083914
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)