BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10a15f (626 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_34219| Best HMM Match : No HMM Matches (HMM E-Value=.) 176 1e-44 SB_36368| Best HMM Match : 14-3-3 (HMM E-Value=0) 173 1e-43 SB_34217| Best HMM Match : No HMM Matches (HMM E-Value=.) 165 3e-41 SB_37955| Best HMM Match : 14-3-3 (HMM E-Value=6.5861e-44) 147 7e-36 SB_34218| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 2e-16 SB_23775| Best HMM Match : Tropomyosin (HMM E-Value=0) 33 0.14 SB_26137| Best HMM Match : Plasmodium_HRP (HMM E-Value=0.27) 31 0.58 SB_42896| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_42068| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_430| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_11347| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_10602| Best HMM Match : RVT_1 (HMM E-Value=1.3e-10) 29 4.1 SB_47927| Best HMM Match : TSP_1 (HMM E-Value=9.5e-34) 28 5.4 SB_15350| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_12646| Best HMM Match : SSrecog (HMM E-Value=0) 28 5.4 SB_12316| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.1 SB_33946| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_10621| Best HMM Match : Peptidase_M24 (HMM E-Value=4.3e-14) 27 9.4 >SB_34219| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 309 Score = 176 bits (429), Expect = 1e-44 Identities = 88/136 (64%), Positives = 101/136 (74%) Frame = +3 Query: 219 MAAAMKEVTETGVELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGSERKQQMAKE 398 MA AMKE TE L EERNLLSVAYKNVVGA+RSSWRVISSIEQK EGSERK+Q + Sbjct: 1 MAKAMKEATEISETLEQEERNLLSVAYKNVVGAKRSSWRVISSIEQKLEGSERKKQNTET 60 Query: 399 YRVKVEKELREICYDVLGLLDKHLIPKASNPESKVFYLKMKGDYYRYLAEVATGETRHSV 578 YR +E EL E+C VL LL+ LIP A + ESKVFYLKMKGDYYRY EVA + R V Sbjct: 61 YRQTIENELNEVCETVLKLLESKLIPNAQSTESKVFYLKMKGDYYRYEGEVAGADRRREV 120 Query: 579 VEDSQKAYQDAFEISK 626 V+ + KAY +A EI++ Sbjct: 121 VQKAMKAYSEAQEIAE 136 >SB_36368| Best HMM Match : 14-3-3 (HMM E-Value=0) Length = 248 Score = 173 bits (420), Expect = 1e-43 Identities = 88/161 (54%), Positives = 113/161 (70%), Gaps = 3/161 (1%) Frame = +3 Query: 138 PSSTMSVDKEELVQRAKLAEQAERYDDMAAAMKEVTETGVELSNEERNLLSVAYKNVVGA 317 P+ +EEL+ AK+AEQAERYDDM AM VT+ G L++EERNLLSVAYKNVVGA Sbjct: 3 PNFVSKCSREELIHLAKMAEQAERYDDMVNAMSAVTKEGKPLNDEERNLLSVAYKNVVGA 62 Query: 318 RRSSWRVISSIEQKTEGSERKQQMAKEYRVKVEKELREICYDVLGLLDKHLIPKAS---N 488 RRSSWRVISS+EQK E + K+YR + EL C +VL +L+ +L+ N Sbjct: 63 RRSSWRVISSMEQK--APEEMAALTKKYREDITNELNGKCAEVLDILENYLLKDGQDDIN 120 Query: 489 PESKVFYLKMKGDYYRYLAEVATGETRHSVVEDSQKAYQDA 611 E+KVFYLKM+GDY+RYL EVA G++R +E S++AY+DA Sbjct: 121 TEAKVFYLKMRGDYHRYLVEVAEGDSRKENIEKSREAYKDA 161 >SB_34217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 219 Score = 165 bits (401), Expect = 3e-41 Identities = 81/138 (58%), Positives = 107/138 (77%) Frame = +3 Query: 150 MSVDKEELVQRAKLAEQAERYDDMAAAMKEVTETGVELSNEERNLLSVAYKNVVGARRSS 329 M V +E L+ AKL+EQ +RYD+MA MKEV+E +LS EERNLLSV+YKN+VG RRSS Sbjct: 80 MMVVRETLIYNAKLSEQCDRYDEMAKIMKEVSEKYPKLSKEERNLLSVSYKNIVGQRRSS 139 Query: 330 WRVISSIEQKTEGSERKQQMAKEYRVKVEKELREICYDVLGLLDKHLIPKASNPESKVFY 509 WRVISSIE+KT S + K+Y+ +EKEL+++C +VLG+L++ LIP A + E+KVFY Sbjct: 140 WRVISSIEEKTAESS-SLAIVKKYKACIEKELKDLCKEVLGILER-LIPGAEDEENKVFY 197 Query: 510 LKMKGDYYRYLAEVATGE 563 K+KGDYYRYLAE + G+ Sbjct: 198 FKLKGDYYRYLAEFSHGQ 215 >SB_37955| Best HMM Match : 14-3-3 (HMM E-Value=6.5861e-44) Length = 251 Score = 147 bits (356), Expect = 7e-36 Identities = 75/123 (60%), Positives = 93/123 (75%), Gaps = 3/123 (2%) Frame = +3 Query: 159 DKEELVQRAKLAEQAERYDDMAAAMKEVTETGVELSNEERNLLSVAYKNVVGARRSSWRV 338 DKEE V AKLAEQAERYDDM +MKEV + G ELS E+RNLLSVAYKNV+GARR+SWR+ Sbjct: 3 DKEEHVYMAKLAEQAERYDDMVNSMKEVAKMGTELSTEDRNLLSVAYKNVIGARRASWRI 62 Query: 339 ISSIEQKTE--GSE-RKQQMAKEYRVKVEKELREICYDVLGLLDKHLIPKASNPESKVFY 509 I+SIEQK E G + K +M + YR +E+EL+ IC ++L LLD LI + + ESKVFY Sbjct: 63 ITSIEQKEESKGEDMAKLEMIRNYRKTIEEELKTICGEILSLLDDSLIKNSQSEESKVFY 122 Query: 510 LKM 518 K+ Sbjct: 123 NKI 125 >SB_34218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 607 Score = 83.0 bits (196), Expect = 2e-16 Identities = 43/102 (42%), Positives = 63/102 (61%), Gaps = 2/102 (1%) Frame = +3 Query: 150 MSVDKEELVQRAKLAEQAERYDDMAAAMKEVTETGVELSNEERNLLSVAYKNVVGARRSS 329 M + ELVQ AKLAEQ ER++D+ MK+ E L+ E RNLLSV YKNVVG++R + Sbjct: 186 MQDSRNELVQLAKLAEQTERFEDVILYMKKAIEINPSLNKEHRNLLSVGYKNVVGSKRFA 245 Query: 330 WRVISSIEQKTEGSERKQQMAK--EYRVKVEKELREICYDVL 449 WR + ++ R Q+ +Y+ K+E EL+ +C ++L Sbjct: 246 WRHLHHDALQSGRYIRDSQLKGIIKYKEKIEMELKTLCREIL 287 >SB_23775| Best HMM Match : Tropomyosin (HMM E-Value=0) Length = 442 Score = 33.5 bits (73), Expect = 0.14 Identities = 23/86 (26%), Positives = 40/86 (46%) Frame = +3 Query: 162 KEELVQRAKLAEQAERYDDMAAAMKEVTETGVELSNEERNLLSVAYKNVVGARRSSWRVI 341 KE+ AK ++ ER + A K+ E + EE++ L K R+ + Sbjct: 339 KEKERLEAKQKKEQERLEKQAEKEKKEKERLEKKQREEKDRLEKKEKKEEEKRKKEEEIN 398 Query: 342 SSIEQKTEGSERKQQMAKEYRVKVEK 419 + IE+K + E+K+Q +E K E+ Sbjct: 399 AKIEEKKKREEKKKQEEEEKMKKKEQ 424 >SB_26137| Best HMM Match : Plasmodium_HRP (HMM E-Value=0.27) Length = 271 Score = 31.5 bits (68), Expect = 0.58 Identities = 26/135 (19%), Positives = 53/135 (39%), Gaps = 1/135 (0%) Frame = +3 Query: 15 PRSRQNQYIVQRKRKTDIVLKFAGSNTFFPFRQGHQ*ISPLPSSTMSVDKEELVQR-AKL 191 PR+R + Y+V V+ + + +Q +S M +KE ++ A+ Sbjct: 25 PRARDDSYLVPSDAPKKRVILYLVNGVKLALQQPGNQVSRNGREGMGTEKEAQTEKEAQT 84 Query: 192 AEQAERYDDMAAAMKEVTETGVELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGS 371 ++AER + + TE + E + + + R I + +K + Sbjct: 85 EKEAEREKEAETEKEAQTEKEAQTEKEAEREKEAETEKEAEREKEAEREIEAETEKEAET 144 Query: 372 ERKQQMAKEYRVKVE 416 E++ Q KE + + E Sbjct: 145 EKEAQTEKEAQTEKE 159 >SB_42896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 994 Score = 30.3 bits (65), Expect = 1.3 Identities = 16/51 (31%), Positives = 28/51 (54%) Frame = +3 Query: 126 ISPLPSSTMSVDKEELVQRAKLAEQAERYDDMAAAMKEVTETGVELSNEER 278 +SPLPS+ +E+V KLAE+ E ++++ T+ E + EE+ Sbjct: 643 VSPLPSTATEDQMQEVVDSNKLAEKKEVTEEVSPVKPLSTKESKENALEEK 693 >SB_42068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3367 Score = 29.9 bits (64), Expect = 1.8 Identities = 28/121 (23%), Positives = 55/121 (45%), Gaps = 12/121 (9%) Frame = +3 Query: 147 TMSVDKEELVQRAKLAEQAERY---DDMAAAMKEVTETGVELSNE-ERNLLSVAYKNVVG 314 ++S+ +EL + LA Q + D A K+VT ++ + E R + + Sbjct: 3123 SLSLKSQELEAKNALANQKLKQMVKDQQEAEKKKVTSMEIQTTIETHRKQTIIEMVSCAA 3182 Query: 315 ARRSSWR--------VISSIEQKTEGSERKQQMAKEYRVKVEKELREICYDVLGLLDKHL 470 R S++ + SS++++T+ + KQQ + +VE + E V G+ +HL Sbjct: 3183 CLRKSYQESAFLDLLITSSLQKQTKQIKEKQQAVMKDLAQVEPAVDEARQAVKGIKKQHL 3242 Query: 471 I 473 + Sbjct: 3243 V 3243 >SB_430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2202 Score = 29.5 bits (63), Expect = 2.3 Identities = 22/100 (22%), Positives = 52/100 (52%), Gaps = 3/100 (3%) Frame = +3 Query: 138 PSSTMSVDKEELVQRAKLAEQAERYDDMAAAMKEVTETGVELSNEERNLL-SVAYKNVVG 314 PSS S DK+E+ +++ +++++ ++A K + E ++S + S+ K + Sbjct: 1066 PSSRSSHDKDEISEKSNPSDKSD--VEVARKNKHMPEALYKISETISGMNDSITLKEPLK 1123 Query: 315 ARRSSWR--VISSIEQKTEGSERKQQMAKEYRVKVEKELR 428 A+ R ++ + E +R+ + K++R++ EK+ R Sbjct: 1124 AKDGDGRNKEEQELKDRMENEKREDTIRKQHRLQWEKKAR 1163 >SB_11347| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1234 Score = 29.5 bits (63), Expect = 2.3 Identities = 27/115 (23%), Positives = 52/115 (45%), Gaps = 6/115 (5%) Frame = +3 Query: 162 KEELVQRAKLAEQAERYDDMAAAMKEVTETGVELSNEERNLLSVAYKNVVGAR------R 323 ++ L + K A +R +A+A+ + + + LS K VV + + Sbjct: 279 QKTLSEMFKQAVTEDRPKMLASAITKALNQDIHSPSALNLPLSTPAKQVVKTKWDRIREK 338 Query: 324 SSWRVISSIEQKTEGSERKQQMAKEYRVKVEKELREICYDVLGLLDKHLIPKASN 488 W ++S E+ +ER++Q E +VK E++ R+ ++ + HL K SN Sbjct: 339 HQWNLLSEDEKNKIKAERRKQKRLELKVKREEKERKRLEELKRVSFAHLGMKLSN 393 >SB_10602| Best HMM Match : RVT_1 (HMM E-Value=1.3e-10) Length = 416 Score = 28.7 bits (61), Expect = 4.1 Identities = 15/61 (24%), Positives = 30/61 (49%) Frame = +3 Query: 444 VLGLLDKHLIPKASNPESKVFYLKMKGDYYRYLAEVATGETRHSVVEDSQKAYQDAFEIS 623 +LGL++ H+ PK+ + ++F +Y+ +L V T+ +E + Y + S Sbjct: 116 ILGLIESHIDPKSFH--HRMFLAACCLEYFGFLRSVEFTVTQEKCIEQNMPLYAVFIDFS 173 Query: 624 K 626 K Sbjct: 174 K 174 >SB_47927| Best HMM Match : TSP_1 (HMM E-Value=9.5e-34) Length = 512 Score = 28.3 bits (60), Expect = 5.4 Identities = 20/85 (23%), Positives = 43/85 (50%), Gaps = 1/85 (1%) Frame = +3 Query: 180 RAKLAEQAERYDDMAAAM-KEVTETGVELSNEERNLLSVAYKNVVGARRSSWRVISSIEQ 356 + K+ +++E+YD + + KE T+ G + E + N AR + ++ + Sbjct: 13 KRKIFKKSEKYDRLEEPLEKEGTDGGEIEAEAEVEPHTEEEANYNEARSENCEKNNNNDS 72 Query: 357 KTEGSERKQQMAKEYRVKVEKELRE 431 T ++ +Q KE+ V +EK+L++ Sbjct: 73 STPDAKSQQADIKEWIVSLEKQLKD 97 >SB_15350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1126 Score = 28.3 bits (60), Expect = 5.4 Identities = 13/35 (37%), Positives = 22/35 (62%) Frame = +3 Query: 333 RVISSIEQKTEGSERKQQMAKEYRVKVEKELREIC 437 R++ IE+K E E ++ AKE + + E+E + IC Sbjct: 919 RIMKEIEEK-EKKEEAERKAKEEKEREERERKRIC 952 >SB_12646| Best HMM Match : SSrecog (HMM E-Value=0) Length = 783 Score = 28.3 bits (60), Expect = 5.4 Identities = 11/34 (32%), Positives = 22/34 (64%) Frame = +3 Query: 378 KQQMAKEYRVKVEKELREICYDVLGLLDKHLIPK 479 K++M ++Y K+EKE+ Y+++ L K ++ K Sbjct: 292 KEEMKEKYDGKIEKEMSGAIYEIISRLMKAVVGK 325 >SB_12316| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 676 Score = 27.9 bits (59), Expect = 7.1 Identities = 26/99 (26%), Positives = 47/99 (47%) Frame = +3 Query: 135 LPSSTMSVDKEELVQRAKLAEQAERYDDMAAAMKEVTETGVELSNEERNLLSVAYKNVVG 314 L S+ +D+E R +++++ RY + A MK V E + ++E + + Sbjct: 539 LDSNLSKLDQEVRGLREEISQEESRYHYLHAMMK-VLEIQQKRIDDEMKAYTAQDQ---A 594 Query: 315 ARRSSWRVISSIEQKTEGSERKQQMAKEYRVKVEKELRE 431 R+ SWR EQ T + ++ + K R K +K +RE Sbjct: 595 DRKKSWR-----EQYTRKIQEQENLGKSLREK-QKAVRE 627 >SB_33946| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 27.5 bits (58), Expect = 9.4 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +3 Query: 438 YDVLGLLDKHLIPKASNPESKVFYLKMKGDYY 533 YD ++ HL+P A +++ +K+ DYY Sbjct: 6 YDSNTVVSHHLLPSAQTRYIRIYPVKVNSDYY 37 >SB_10621| Best HMM Match : Peptidase_M24 (HMM E-Value=4.3e-14) Length = 708 Score = 27.5 bits (58), Expect = 9.4 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +3 Query: 207 RYDDMAAAMKEVTETGVELSNEERNLLSV 293 +YD++ AA+K+ T TG+ S + L V Sbjct: 57 KYDNLLAAVKDATNTGIRESGIDARLCDV 85 Score = 27.5 bits (58), Expect = 9.4 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +3 Query: 207 RYDDMAAAMKEVTETGVELSNEERNLLSV 293 +YD++ AA+K+ T TG+ S + L V Sbjct: 163 KYDNLLAAVKDATNTGIRESGIDARLCDV 191 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,545,600 Number of Sequences: 59808 Number of extensions: 383126 Number of successful extensions: 1165 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 1083 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1161 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1560464625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -