BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10a11r (726 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_11234| Best HMM Match : DSPc (HMM E-Value=2.4e-29) 37 0.014 SB_2237| Best HMM Match : Vicilin_N (HMM E-Value=2.5) 35 0.058 SB_33134| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_3143| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_67| Best HMM Match : Ribosomal_S13_N (HMM E-Value=5.2) 33 0.18 SB_10204| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.31 SB_53103| Best HMM Match : DUF1388 (HMM E-Value=0.29) 32 0.41 SB_51224| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_15453| Best HMM Match : Prenyltrans (HMM E-Value=0) 32 0.54 SB_50057| Best HMM Match : NACHT (HMM E-Value=1.4e-08) 31 0.72 SB_40942| Best HMM Match : 7tm_1 (HMM E-Value=1.4013e-45) 31 0.95 SB_22720| Best HMM Match : KID (HMM E-Value=0.0014) 31 0.95 SB_44756| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_26831| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_49251| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_32678| Best HMM Match : HEAT (HMM E-Value=9.6e-18) 30 1.7 SB_25374| Best HMM Match : DUF1087 (HMM E-Value=3.2) 30 1.7 SB_5248| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_51014| Best HMM Match : DUF963 (HMM E-Value=4.7e-07) 30 2.2 SB_26060| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45) 30 2.2 SB_20424| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_56456| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_14816| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_48789| Best HMM Match : M (HMM E-Value=1.3e-10) 29 3.8 SB_39987| Best HMM Match : FtsL (HMM E-Value=0.4) 29 3.8 SB_44100| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.1 SB_41617| Best HMM Match : RVT_1 (HMM E-Value=0) 29 5.1 SB_52226| Best HMM Match : Cytadhesin_P30 (HMM E-Value=9) 28 6.7 SB_43321| Best HMM Match : Laminin_A (HMM E-Value=0.76) 28 6.7 SB_29860| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_22450| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_1489| Best HMM Match : Pentapeptide_2 (HMM E-Value=0.77) 28 6.7 SB_46755| Best HMM Match : zf-C2H2 (HMM E-Value=1.09301e-43) 28 6.7 SB_57555| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_47440| Best HMM Match : SURF6 (HMM E-Value=0.96) 28 8.9 SB_40593| Best HMM Match : UCH (HMM E-Value=1.4e-07) 28 8.9 >SB_11234| Best HMM Match : DSPc (HMM E-Value=2.4e-29) Length = 2072 Score = 37.1 bits (82), Expect = 0.014 Identities = 28/83 (33%), Positives = 42/83 (50%), Gaps = 1/83 (1%) Frame = -1 Query: 639 NQPTECHNYTSHKYEDLKMRNSSNYQQEKLPSNYKTSRRESATKHKLECSKKETSK-KFQ 463 N+ TE S + E KM+NS + + +L S +E TK K S+K + K ++ Sbjct: 1020 NERTELEK--SFRQERTKMKNSHDKEMVQLESREDQLTKEMDTKLKKLTSEKNSIKAEYV 1077 Query: 462 SKRTKLNTETEEWNDSSHLLWQN 394 SK +L +E EE N S L +N Sbjct: 1078 SKIARLQSELEESNQRSRLDIEN 1100 >SB_2237| Best HMM Match : Vicilin_N (HMM E-Value=2.5) Length = 127 Score = 35.1 bits (77), Expect = 0.058 Identities = 23/99 (23%), Positives = 44/99 (44%) Frame = -1 Query: 618 NYTSHKYEDLKMRNSSNYQQEKLPSNYKTSRRESATKHKLECSKKETSKKFQSKRTKLNT 439 NY S++ E++ R + ++ K P ++ T++ ++KE K RT T Sbjct: 25 NYGSNRKEEIPKRTMAPTERRKYPKELWLQQKGGNTQNNYGSNRKEEIPK----RTMAPT 80 Query: 438 ETEEWNDSSHLLWQNRNSNKRHANLMPEELPFTNYVSNQ 322 E ++ L + N+ K + + EE+P T V + Sbjct: 81 ERRKYPKELWLQQKGGNTQKNYGSNRKEEIPKTTIVPTE 119 >SB_33134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2208 Score = 33.9 bits (74), Expect = 0.13 Identities = 25/119 (21%), Positives = 45/119 (37%), Gaps = 1/119 (0%) Frame = -1 Query: 609 SHKYEDLKMRNSSNYQQEKLPSNYKTSRRESATKHKLECSKKETSKKFQSKRTKLNTETE 430 +H+ + K+ + + + R++ + ++ K + SKK QSK +L TE Sbjct: 1062 THEAANSKLSEDNERLTNNAAAKAQNIERDAIIQQLMD-EKSQMSKKLQSKEDELATEKA 1120 Query: 429 EWNDSSHLLWQNRNSNKR-HANLMPEELPFTNYVSNQMASQYQSEFLNSHLVTSNVQTM 256 + L R K H N+ E T A S + H + N+Q + Sbjct: 1121 NSQKHTETLSSQRAKEKELHTNIKELEAKITTLTEESQAKLKASSY-EKHQLVKNIQLL 1178 >SB_3143| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 322 Score = 33.9 bits (74), Expect = 0.13 Identities = 24/101 (23%), Positives = 46/101 (45%) Frame = -1 Query: 492 SKKETSKKFQSKRTKLNTETEEWNDSSHLLWQNRNSNKRHANLMPEELPFTNYVSNQMAS 313 S +E + +S+ LN E NDS + + + + K NL+ E N Sbjct: 159 SSEEEDGEIESEDNSLNNSHSE-NDSKNRVSEKKYEEKTGENLVTETYQEQKSYQNSDYE 217 Query: 312 QYQSEFLNSHLVTSNVQTMGHNVDRTLASFSGTSRANFNLS 190 + +S+ + +S + + N D + +F+G+SR ++LS Sbjct: 218 RQKSDRERTEAESSQITS--RNTDESKETFAGSSRLPYDLS 256 >SB_67| Best HMM Match : Ribosomal_S13_N (HMM E-Value=5.2) Length = 243 Score = 33.5 bits (73), Expect = 0.18 Identities = 27/103 (26%), Positives = 44/103 (42%), Gaps = 8/103 (7%) Frame = -1 Query: 582 RNSSNYQQEKLPS-NYKTSRRESATKHKL-----ECSKKETSKKFQSKRT-KLNTET-EE 427 R E++P N + RR+ K + S KE ++K +R +L E + Sbjct: 122 RRKGELMPERMPDWNKMSDRRKGELMPKRMPDWNKMSDKEIAEKMSDRRKGELMPERMPD 181 Query: 426 WNDSSHLLWQNRNSNKRHANLMPEELPFTNYVSNQMASQYQSE 298 WN S R ++R LMPE +P N +S++ + E Sbjct: 182 WNKMSDRRKDERQRDRRKGELMPERMPDWNKMSDRRKGELMPE 224 Score = 30.7 bits (66), Expect = 1.3 Identities = 26/117 (22%), Positives = 44/117 (37%), Gaps = 2/117 (1%) Frame = -1 Query: 582 RNSSNYQQEKLPSNYKTSRRESATKHKLECSKKETSKKFQSKRTK--LNTETEEWNDSSH 409 R E++P K S R K +L + K +R + +WN S Sbjct: 103 RRKGELMPERMPDWNKMSDRR---KGELMPERMPDWNKMSDRRKGELMPKRMPDWNKMSD 159 Query: 408 LLWQNRNSNKRHANLMPEELPFTNYVSNQMASQYQSEFLNSHLVTSNVQTMGHNVDR 238 + S++R LMPE +P N +S++ + Q + L+ + DR Sbjct: 160 KEIAEKMSDRRKGELMPERMPDWNKMSDRRKDERQRDRRKGELMPERMPDWNKMSDR 216 Score = 29.1 bits (62), Expect = 3.8 Identities = 14/54 (25%), Positives = 25/54 (46%) Frame = -1 Query: 459 KRTKLNTETEEWNDSSHLLWQNRNSNKRHANLMPEELPFTNYVSNQMASQYQSE 298 K+ + +WN S + S++R LMPE +P N +S++ + E Sbjct: 20 KKALMPEHMPDWNKMSDKEIVEKMSDRRKGELMPERMPDWNKMSDRRKGELMPE 73 >SB_10204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 415 Score = 32.7 bits (71), Expect = 0.31 Identities = 40/182 (21%), Positives = 76/182 (41%), Gaps = 8/182 (4%) Frame = -1 Query: 708 QNSGNLMTGNY---ASGPFPGDFIDYNQPTECHNYTSHKYEDLKMRNSSNYQQEKLPSNY 538 +N N T NY A+ + I+ T NY++ E+ + + NY K NY Sbjct: 129 ENYSNKATENYSNKATENYSTKAIENYSTTAIENYSTKATENYSTKATENY-STKATENY 187 Query: 537 KTSRRESATKHKLECSKKETSKKFQSKRTK-LNTE-TEEWNDSSHLLWQNRN-SNKRHAN 367 T E+ + E + ++ + +K T+ +T+ TE ++ + + N S K N Sbjct: 188 STKATENYSTKAAENYSTKATENYSTKATENYSTKATENYSTKATENYTTENYSTKATEN 247 Query: 366 LMPEELPFTNYVSNQMASQYQSEFLNSH--LVTSNVQTMGHNVDRTLASFSGTSRANFNL 193 + + NY S + Y ++ + ++ T N T A+ + +++A N Sbjct: 248 YSTKAI--ENY-STKATENYSTKAIKNYSTKATKNYSTKATENYSNKATKNYSTKATENY 304 Query: 192 ST 187 ST Sbjct: 305 ST 306 >SB_53103| Best HMM Match : DUF1388 (HMM E-Value=0.29) Length = 462 Score = 32.3 bits (70), Expect = 0.41 Identities = 21/88 (23%), Positives = 39/88 (44%), Gaps = 6/88 (6%) Frame = -1 Query: 597 EDLKMRNSSNYQQEKLPS------NYKTSRRESATKHKLECSKKETSKKFQSKRTKLNTE 436 E+ K RN+ Q++KLP + K +R E+ + + + + +E + K+ + Sbjct: 73 EEGKNRNTRRRQEQKLPEEGKNKKHQKRARTETTRRGQEQKTPEEGKNRNHQKKARTENT 132 Query: 435 TEEWNDSSHLLWQNRNSNKRHANLMPEE 352 + +NRN+ KR PEE Sbjct: 133 RRRQGEKPPEEGKNRNTRKRQEQKTPEE 160 >SB_51224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 808 Score = 31.9 bits (69), Expect = 0.54 Identities = 24/108 (22%), Positives = 47/108 (43%), Gaps = 2/108 (1%) Frame = -1 Query: 588 KMRNSSNYQQEKLPSNYKTSRRESATK--HKLECSKKETSKKFQSKRTKLNTETEEWNDS 415 K N + +K+ NY+ +ES K +L+ +K K FQS + + ++ D Sbjct: 537 KSVNGLEKEIKKMEQNYELKSKESDEKFHRELQNTKDRLQKDFQSFHQRTSENSQSMQDR 596 Query: 414 SHLLWQNRNSNKRHANLMPEELPFTNYVSNQMASQYQSEFLNSHLVTS 271 L + RNS + + + EL + +++ +++ LV S Sbjct: 597 ILKLEEERNSLEVEVSRLRSELVSSKLKADEDLMNAKTKLKQEELVRS 644 >SB_15453| Best HMM Match : Prenyltrans (HMM E-Value=0) Length = 2376 Score = 31.9 bits (69), Expect = 0.54 Identities = 31/149 (20%), Positives = 61/149 (40%), Gaps = 9/149 (6%) Frame = -1 Query: 651 FIDYNQPTECHNYTSHKYEDLKMRNSSNYQQEKLPSNYKTSR---RESATKHKLECSKKE 481 F+ PT HN ++Y + + SN L R S +++ CSK + Sbjct: 1921 FVPSADPTSIHNLWRYRYHTICTKRQSNQYSRPLAGECDIVRLVDLSSCSEYVSHCSKHQ 1980 Query: 480 TSKKFQSKR-TKLNTETEEWNDSSHLLWQNRNSNKRHANLMPEELPFTNYVS--NQMASQ 310 + ++ T L+ T + S + Q+R+ H + P++ T S M Sbjct: 1981 PIGESDPRQATPLHAPTPRLDMSRSGIGQSRSEMGLHTSKQPQKQTKTRTKSAVKFMGET 2040 Query: 309 YQSEFLNSHLVT---SNVQTMGHNVDRTL 232 +++ + ++T ++V G +VD+ L Sbjct: 2041 HKAPVIKGSVITPGRAHVTHTGSDVDQGL 2069 >SB_50057| Best HMM Match : NACHT (HMM E-Value=1.4e-08) Length = 1555 Score = 31.5 bits (68), Expect = 0.72 Identities = 21/91 (23%), Positives = 43/91 (47%) Frame = -1 Query: 639 NQPTECHNYTSHKYEDLKMRNSSNYQQEKLPSNYKTSRRESATKHKLECSKKETSKKFQS 460 ++P++ ++ + YE + S Y++ + +R+ +HK K+ +K S Sbjct: 1378 DEPSDGYHGDNKDYEGWRSPRSG-YRRSGISGESHENRKNKKKEHK----KRMHAKIKHS 1432 Query: 459 KRTKLNTETEEWNDSSHLLWQNRNSNKRHAN 367 KR + +W D + L + N+N+N H N Sbjct: 1433 KRMFEVPDQLDWRDYALLRYVNKNNNDTHYN 1463 >SB_40942| Best HMM Match : 7tm_1 (HMM E-Value=1.4013e-45) Length = 358 Score = 31.1 bits (67), Expect = 0.95 Identities = 21/77 (27%), Positives = 35/77 (45%) Frame = -1 Query: 516 ATKHKLECSKKETSKKFQSKRTKLNTETEEWNDSSHLLWQNRNSNKRHANLMPEELPFTN 337 A KH L C+ T + +++ E S+ + RNS ++ + EL + Sbjct: 285 AFKHILCCNLVATGRAMDQFIARVSGEASNGVSSNEMALAMRNSGQQQIS----ELRCAS 340 Query: 336 YVSNQMASQYQSEFLNS 286 Y+SNQM S Q + N+ Sbjct: 341 YMSNQMTSDKQCKLTNA 357 >SB_22720| Best HMM Match : KID (HMM E-Value=0.0014) Length = 847 Score = 31.1 bits (67), Expect = 0.95 Identities = 17/53 (32%), Positives = 23/53 (43%) Frame = -1 Query: 561 QEKLPSNYKTSRRESATKHKLECSKKETSKKFQSKRTKLNTETEEWNDSSHLL 403 QEKL K S + KLE KE K +++L E ++HLL Sbjct: 736 QEKLEGVSKASEQSKTHAQKLESLNKEQENKLVDAQSRLEESEAEGRKTAHLL 788 >SB_44756| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 320 Score = 30.7 bits (66), Expect = 1.3 Identities = 33/149 (22%), Positives = 61/149 (40%) Frame = -1 Query: 633 PTECHNYTSHKYEDLKMRNSSNYQQEKLPSNYKTSRRESATKHKLECSKKETSKKFQSKR 454 P+E Y++ E+ + + NY K NY T E+ + E + ++K+ +K Sbjct: 8 PSEYITYSTKATENYSTKATENY-STKASENYSTKATENYSTKASENYSTKATEKYSTKA 66 Query: 453 TKLNTETEEWNDSSHLLWQNRNSNKRHANLMPEELPFTNYVSNQMASQYQSEFLNSHLVT 274 + N T+ + S +N S K N + T S + Y ++ + + T Sbjct: 67 AE-NYSTKATENYSTKATEN-YSTKAAENYSTKA---TENYSTKATENYSTK-ASENYTT 120 Query: 273 SNVQTMGHNVDRTLASFSGTSRANFNLST 187 N T T A+ + +++A N ST Sbjct: 121 ENYSTKAAEKYSTKATENYSTKATENYST 149 >SB_26831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 932 Score = 30.7 bits (66), Expect = 1.3 Identities = 24/100 (24%), Positives = 44/100 (44%), Gaps = 2/100 (2%) Frame = -1 Query: 525 RESATKHKLECSKKETSKKFQSKRTKLNTET--EEWNDSSHLLWQNRNSNKRHANLMPEE 352 ++ T K + +K E+ + K T+ E+ DS L+ + + K+ ANL EE Sbjct: 264 KKQLTDVKNQLAKSESQLQAAEKDLAFKTQELKEKVQDSEELIKASNENIKKAANLS-EE 322 Query: 351 LPFTNYVSNQMASQYQSEFLNSHLVTSNVQTMGHNVDRTL 232 L T + +Q+ +Q +S + + HN D + Sbjct: 323 LMKTKSLLDQVKAQLESSEAKCKQLGKEMDCQKHNFDSVI 362 >SB_49251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1560 Score = 30.3 bits (65), Expect = 1.7 Identities = 20/64 (31%), Positives = 33/64 (51%) Frame = -1 Query: 549 PSNYKTSRRESATKHKLECSKKETSKKFQSKRTKLNTETEEWNDSSHLLWQNRNSNKRHA 370 P+ S ++ K + KKE K Q K+T LNT E+ DS L +R+S+ + + Sbjct: 722 PATPSLSVLKAGMKVTFDDKKKEDDSKKQ-KKTDLNTVLEDDEDSVSLSSSHRSSSSQSS 780 Query: 369 NLMP 358 + +P Sbjct: 781 SPVP 784 >SB_32678| Best HMM Match : HEAT (HMM E-Value=9.6e-18) Length = 844 Score = 30.3 bits (65), Expect = 1.7 Identities = 17/67 (25%), Positives = 31/67 (46%), Gaps = 1/67 (1%) Frame = -1 Query: 621 HNYTSHKYEDLKMRNSSNYQQEKLPSNYKTSRRESATKHKLECSKKETS-KKFQSKRTKL 445 H++ Y +LK+R SS+Y + L T + +L K ++S +KF S Sbjct: 543 HDFDYDDYHELKLRRSSSYDDDLLLDGMVTPHQIGVLLRRLHGCKDDSSVRKFVSDIIIK 602 Query: 444 NTETEEW 424 +++W Sbjct: 603 FAHSQQW 609 >SB_25374| Best HMM Match : DUF1087 (HMM E-Value=3.2) Length = 144 Score = 30.3 bits (65), Expect = 1.7 Identities = 28/128 (21%), Positives = 55/128 (42%) Frame = -1 Query: 579 NSSNYQQEKLPSNYKTSRRESATKHKLECSKKETSKKFQSKRTKLNTETEEWNDSSHLLW 400 NS N + L S+ S ++ + S + K S KLN+ + N+S+ Sbjct: 19 NSDNLNSDNLNSDKLKSDNSNSDNSNSDNSNSDKLKSDNSNSEKLNSNNSDSNNSNSDNS 78 Query: 399 QNRNSNKRHANLMPEELPFTNYVSNQMASQYQSEFLNSHLVTSNVQTMGHNVDRTLASFS 220 + NSN ++N ++L N + S + + +NS+ + + + N D + + S Sbjct: 79 NSDNSNSDNSN--SDKLKLVNSNPDNSNSD-KLKLVNSN--SDKLNSDNSNSDNSNSDNS 133 Query: 219 GTSRANFN 196 + +N N Sbjct: 134 NSDNSNSN 141 >SB_5248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1311 Score = 30.3 bits (65), Expect = 1.7 Identities = 26/80 (32%), Positives = 37/80 (46%), Gaps = 3/80 (3%) Frame = -1 Query: 576 SSNYQQEKLPSN--YKTSRRESATKHKLECSKKETSKKFQ-SKRTKLNTETEEWNDSSHL 406 SSN + E P N + + S+ K KL+ KE K Q S R K N E + SH Sbjct: 977 SSNSRIEDNPCNEGIDNNGKISSGKSKLKRISKEDGKHSQMSHRHKENNGKSEVDTDSHK 1036 Query: 405 LWQNRNSNKRHANLMPEELP 346 NR+ +++H E+ P Sbjct: 1037 EDINRDRDRQHRRSKAEKKP 1056 >SB_51014| Best HMM Match : DUF963 (HMM E-Value=4.7e-07) Length = 206 Score = 29.9 bits (64), Expect = 2.2 Identities = 27/111 (24%), Positives = 51/111 (45%), Gaps = 2/111 (1%) Frame = -1 Query: 546 SNYKTSRRESATKH-KLECSKKETSKKF-QSKRTKLNTETEEWNDSSHLLWQNRNSNKRH 373 +N K++ +AT++ + + T+ ++ +K T LNT TE N S LL + Sbjct: 89 TNTKSTLLNTATEYTNTKSTLLNTATEYTNTKSTLLNTATEYTNTKSTLLNTATDYTNTE 148 Query: 372 ANLMPEELPFTNYVSNQMASQYQSEFLNSHLVTSNVQTMGHNVDRTLASFS 220 + L+ +TN S + + +E+ N+ N+ T N TL + + Sbjct: 149 STLLNTATEYTNTKSTLLNT--ATEYTNTKSTLMNIVTEYTNTKITLMNIA 197 Score = 27.9 bits (59), Expect = 8.9 Identities = 23/77 (29%), Positives = 31/77 (40%) Frame = -1 Query: 462 SKRTKLNTETEEWNDSSHLLWQNRNSNKRHANLMPEELPFTNYVSNQMASQYQSEFLNSH 283 +K T LNT TE N S LL + LM +TN S + +E+ N+ Sbjct: 7 TKSTLLNTATEYTNTKSTLLNTATEYTNTKSTLMNIATEYTNTKSTLL--NIATEYTNTK 64 Query: 282 LVTSNVQTMGHNVDRTL 232 N+ T N TL Sbjct: 65 STLMNIATEYTNTKITL 81 >SB_26060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2671 Score = 29.9 bits (64), Expect = 2.2 Identities = 15/40 (37%), Positives = 24/40 (60%) Frame = -1 Query: 531 SRRESATKHKLECSKKETSKKFQSKRTKLNTETEEWNDSS 412 S +ES+T K +CSK++ S K +K L + +W DS+ Sbjct: 528 SSKESSTSCK-KCSKEQMSNKENTKCVDLPLQNIQWEDST 566 >SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45) Length = 4160 Score = 29.9 bits (64), Expect = 2.2 Identities = 23/89 (25%), Positives = 40/89 (44%), Gaps = 6/89 (6%) Frame = -1 Query: 597 EDLKMRNSSNYQQEKLPSN------YKTSRRESATKHKLECSKKETSKKFQSKRTKLNTE 436 EDLK R +QEK + Y+ +++S + +L S+ E + F+SK + E Sbjct: 3600 EDLKHRLLRETEQEKKLHDGLKKDLYEAEKQKSDLQRELNQSRYEI-ESFKSKVELIEIE 3658 Query: 435 TEEWNDSSHLLWQNRNSNKRHANLMPEEL 349 +W + L + N + + EEL Sbjct: 3659 NRKWEEERRKLKEEANYANKELRSIQEEL 3687 >SB_20424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1711 Score = 29.9 bits (64), Expect = 2.2 Identities = 31/128 (24%), Positives = 58/128 (45%) Frame = -1 Query: 618 NYTSHKYEDLKMRNSSNYQQEKLPSNYKTSRRESATKHKLECSKKETSKKFQSKRTKLNT 439 N + + E +++ S+NY K Y+T + L S++E SKK+ K Sbjct: 1278 NELAEQAERIRVFESNNYGDAK--ELYETCNKLENEIGTLRESREELSKKYTQSVAK--- 1332 Query: 438 ETEEWNDSSHLLWQNRNSNKRHANLMPEELPFTNYVSNQMASQYQSEFLNSHLVTSNVQT 259 E E +HL+ + SNK+ L+ EE+ + + + ++ QSE + + Sbjct: 1333 EKE----LTHLV-ETLRSNKKQLELLVEEMKNESMLVEEQLNESQSEL---ETTRESCTS 1384 Query: 258 MGHNVDRT 235 M +++RT Sbjct: 1385 MNSDLERT 1392 >SB_56456| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1266 Score = 29.5 bits (63), Expect = 2.9 Identities = 21/71 (29%), Positives = 31/71 (43%), Gaps = 1/71 (1%) Frame = -1 Query: 657 GDFIDYNQPTECHNYTSHKYEDLKMRNSSNYQQEKLPSNYKTSRRESATK-HKLECSKKE 481 G +I T NY+ Y R SS + +N SRR ++ K K + S Sbjct: 379 GSYITIRNWTRWSNYSGGGYSISNSRPSSRRNPRETKTNTPRSRRSNSRKTPKSKKSNLS 438 Query: 480 TSKKFQSKRTK 448 T+ QS+R+K Sbjct: 439 TAASDQSERSK 449 >SB_14816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3760 Score = 29.5 bits (63), Expect = 2.9 Identities = 13/43 (30%), Positives = 26/43 (60%) Frame = -1 Query: 504 KLECSKKETSKKFQSKRTKLNTETEEWNDSSHLLWQNRNSNKR 376 K+E K++ + ++++ KLNT EE +D+ L + SN++ Sbjct: 1475 KIEAEKEQLLSELKTQKEKLNTVIEELDDTKSTLEIIKESNEK 1517 >SB_48789| Best HMM Match : M (HMM E-Value=1.3e-10) Length = 2478 Score = 29.1 bits (62), Expect = 3.8 Identities = 18/70 (25%), Positives = 34/70 (48%) Frame = -1 Query: 510 KHKLECSKKETSKKFQSKRTKLNTETEEWNDSSHLLWQNRNSNKRHANLMPEELPFTNYV 331 K KLE + K + K K++ E + D++ L +++S N M E+ + Sbjct: 1206 KQKLE----QEMKAMEGKIKKMDAELQSVKDANRNLTSSKDSMLAEKNAMKSEIMRWSTK 1261 Query: 330 SNQMASQYQS 301 +NQ+ QY++ Sbjct: 1262 TNQLMEQYRN 1271 >SB_39987| Best HMM Match : FtsL (HMM E-Value=0.4) Length = 573 Score = 29.1 bits (62), Expect = 3.8 Identities = 26/98 (26%), Positives = 44/98 (44%), Gaps = 10/98 (10%) Frame = -1 Query: 621 HNYTSHKYEDLKMRNSSNYQQEKLPS-----NYKTSRRESATKHKLECSKKETSKKFQ-- 463 H E+L ++ + ++PS N +T R +A K++ K+ T + Sbjct: 321 HQKVDPSQEELVAKSVTKPGTARMPSTARQRNQQTQSRATAGGIKMDTPKENTPAVMEQP 380 Query: 462 SK---RTKLNTETEEWNDSSHLLWQNRNSNKRHANLMP 358 SK R K+NT+ E+ + L QN + +H NL P Sbjct: 381 SKTLAREKVNTQKEKQQNHVFLEAQNADWAAKHENLSP 418 >SB_44100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 341 Score = 28.7 bits (61), Expect = 5.1 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 2/37 (5%) Frame = -1 Query: 708 QNSGNLMTGNYASGPFPGD--FIDYNQPTECHNYTSH 604 +++ N+ T S P D F YNQ TE HN+T++ Sbjct: 250 ESTTNVATNTTTSLKLPEDIEFCIYNQETELHNFTAY 286 >SB_41617| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 675 Score = 28.7 bits (61), Expect = 5.1 Identities = 14/62 (22%), Positives = 33/62 (53%), Gaps = 1/62 (1%) Frame = -1 Query: 432 EEWNDSSHLLWQNRNSNKRHANLMPEELPFTNYVSNQ-MASQYQSEFLNSHLVTSNVQTM 256 E W H + + R +RH L+P ++ + +Y+SN+ + + + + + L + ++ + Sbjct: 523 ETWTVYQHEVRELRTLQQRHLRLIP-QIKWDDYISNEDVLRRANVDDIETKLARNRLRWL 581 Query: 255 GH 250 GH Sbjct: 582 GH 583 >SB_52226| Best HMM Match : Cytadhesin_P30 (HMM E-Value=9) Length = 264 Score = 28.3 bits (60), Expect = 6.7 Identities = 15/42 (35%), Positives = 18/42 (42%) Frame = -1 Query: 687 TGNYASGPFPGDFIDYNQPTECHNYTSHKYEDLKMRNSSNYQ 562 T N PFPG+ Y QPT T Y + R + YQ Sbjct: 182 TNNPMFRPFPGNPQGYQQPTTNQLPTDQAYRYRRPRGGARYQ 223 >SB_43321| Best HMM Match : Laminin_A (HMM E-Value=0.76) Length = 353 Score = 28.3 bits (60), Expect = 6.7 Identities = 13/46 (28%), Positives = 22/46 (47%) Frame = -1 Query: 459 KRTKLNTETEEWNDSSHLLWQNRNSNKRHANLMPEELPFTNYVSNQ 322 K+ + +WN S + S++R LMPE +P N +S + Sbjct: 145 KKALMPEHMPDWNKMSDKEIVEKMSDRRKGELMPERMPDWNKISEK 190 >SB_29860| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 28.3 bits (60), Expect = 6.7 Identities = 12/43 (27%), Positives = 26/43 (60%) Frame = -1 Query: 540 YKTSRRESATKHKLECSKKETSKKFQSKRTKLNTETEEWNDSS 412 ++ RR+++ KH E +K+E F++ T+L+T+ + + S Sbjct: 21 HQNHRRKNSEKHTQEENKRERGGYFETLVTRLHTQVDSQQNRS 63 >SB_22450| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2806 Score = 28.3 bits (60), Expect = 6.7 Identities = 16/64 (25%), Positives = 31/64 (48%) Frame = -1 Query: 537 KTSRRESATKHKLECSKKETSKKFQSKRTKLNTETEEWNDSSHLLWQNRNSNKRHANLMP 358 K RES ++L ++ K RTK+N ++ ND+ + + K++ +P Sbjct: 1272 KRLNRESVASYELNVVVQDKRTKRTLDRTKVNITVDDSNDNRPIFLK-----KKYLKTIP 1326 Query: 357 EELP 346 E++P Sbjct: 1327 EDIP 1330 >SB_1489| Best HMM Match : Pentapeptide_2 (HMM E-Value=0.77) Length = 872 Score = 28.3 bits (60), Expect = 6.7 Identities = 14/43 (32%), Positives = 18/43 (41%) Frame = -1 Query: 726 FYSNFMQNSGNLMTGNYASGPFPGDFIDYNQPTECHNYTSHKY 598 +Y+ GN GNYA G + G +C NYT Y Sbjct: 641 YYAGGYYTDGNYTDGNYAGGNYAGGNYAGGNYADC-NYTGGNY 682 >SB_46755| Best HMM Match : zf-C2H2 (HMM E-Value=1.09301e-43) Length = 1806 Score = 28.3 bits (60), Expect = 6.7 Identities = 23/76 (30%), Positives = 34/76 (44%), Gaps = 5/76 (6%) Frame = -1 Query: 417 SSHLLWQNRNSNK-RH----ANLMPEELPFTNYVSNQMASQYQSEFLNSHLVTSNVQTMG 253 SS+ NRN + RH L ++P + V+NQMAS + ++ + T Sbjct: 1693 SSYSFTTNRNHTQGRHPCAQGPLSTGQIPLSVSVTNQMASPDSCMYSSNATPYMSYNTNA 1752 Query: 252 HNVDRTLASFSGTSRA 205 + DR L SGT A Sbjct: 1753 YTQDRPLMPHSGTGLA 1768 >SB_57555| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 323 Score = 27.9 bits (59), Expect = 8.9 Identities = 17/68 (25%), Positives = 28/68 (41%), Gaps = 2/68 (2%) Frame = -1 Query: 606 HKYEDLKMRNSSNYQQEKLPSNYKTSRRESATK--HKLECSKKETSKKFQSKRTKLNTET 433 H+ ++ RN + Q + + K +S+ K H L KK++ SK N + Sbjct: 147 HRLSKVEFRNPNIEQSSEFMAEIKEEENDSSEKDKHNLGLKKKDSRPSVVSKDHVSNLDN 206 Query: 432 EEWNDSSH 409 ND H Sbjct: 207 GRDNDQVH 214 >SB_47440| Best HMM Match : SURF6 (HMM E-Value=0.96) Length = 279 Score = 27.9 bits (59), Expect = 8.9 Identities = 17/66 (25%), Positives = 34/66 (51%), Gaps = 2/66 (3%) Frame = -1 Query: 531 SRRESATKHKLECSKKETSKKFQSKRTKLNTETEEWN--DSSHLLWQNRNSNKRHANLMP 358 SR+++A K E + + + + K K N+ +E ++ ++NR S KR + + Sbjct: 6 SRKQAAALKKKEIKRAKRQRLLREKSRKENSSGQEKEILQNTGERFKNRTSKKRVTDKVK 65 Query: 357 EELPFT 340 ++LP T Sbjct: 66 DKLPQT 71 >SB_40593| Best HMM Match : UCH (HMM E-Value=1.4e-07) Length = 711 Score = 27.9 bits (59), Expect = 8.9 Identities = 15/67 (22%), Positives = 31/67 (46%) Frame = -1 Query: 648 IDYNQPTECHNYTSHKYEDLKMRNSSNYQQEKLPSNYKTSRRESATKHKLECSKKETSKK 469 +D N+ ECHN + + + L S + ++ + E +KH+++ S + + Sbjct: 308 VDNNRGVECHNQETVQRKGLTNEESLDCSKKLQDNTAVNDESECFSKHQVQSSGYDCRNE 367 Query: 468 FQSKRTK 448 S+ TK Sbjct: 368 QCSENTK 374 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,464,610 Number of Sequences: 59808 Number of extensions: 438195 Number of successful extensions: 1447 Number of sequences better than 10.0: 37 Number of HSP's better than 10.0 without gapping: 1288 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1420 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1937927537 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -