BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10a08r (722 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT003758-1|AAO41437.1| 1254|Drosophila melanogaster RE51958p pro... 29 4.8 AY094721-1|AAM11074.1| 1028|Drosophila melanogaster GH20168p pro... 29 4.8 AE014297-2061|AAF55209.1| 1254|Drosophila melanogaster CG6045-PA... 29 4.8 AE014297-3099|AAN13902.1| 595|Drosophila melanogaster CG31164-P... 29 8.5 >BT003758-1|AAO41437.1| 1254|Drosophila melanogaster RE51958p protein. Length = 1254 Score = 29.5 bits (63), Expect = 4.8 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = -1 Query: 422 TASADKHYSSINVKKQSSNFGSVECSLSLRTPGLIKFY 309 T S H + + K S S++ S +L+ PG+I FY Sbjct: 551 TTSNTLHCAFVGATKVGSTIDSIDASEALKQPGVIAFY 588 >AY094721-1|AAM11074.1| 1028|Drosophila melanogaster GH20168p protein. Length = 1028 Score = 29.5 bits (63), Expect = 4.8 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = -1 Query: 422 TASADKHYSSINVKKQSSNFGSVECSLSLRTPGLIKFY 309 T S H + + K S S++ S +L+ PG+I FY Sbjct: 325 TTSNTLHCAFVGATKVGSTIDSIDASEALKQPGVIAFY 362 >AE014297-2061|AAF55209.1| 1254|Drosophila melanogaster CG6045-PA protein. Length = 1254 Score = 29.5 bits (63), Expect = 4.8 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = -1 Query: 422 TASADKHYSSINVKKQSSNFGSVECSLSLRTPGLIKFY 309 T S H + + K S S++ S +L+ PG+I FY Sbjct: 551 TTSNTLHCAFVGATKVGSTIDSIDASEALKQPGVIAFY 588 >AE014297-3099|AAN13902.1| 595|Drosophila melanogaster CG31164-PA protein. Length = 595 Score = 28.7 bits (61), Expect = 8.5 Identities = 17/55 (30%), Positives = 30/55 (54%) Frame = +3 Query: 489 REIKSAVG*LEKRNTFFFVSFENQYYLLLVICIYVF*SLICFVQEILLCVYTKVT 653 + IK+ + E++ + +SF++ +L V+CI S + FV EIL Y + T Sbjct: 535 KHIKTTLRESEQQPSHLPLSFDHFKWLWAVLCIAYVMSFMVFVMEILWSKYQRRT 589 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 28,692,654 Number of Sequences: 53049 Number of extensions: 541880 Number of successful extensions: 784 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 747 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 784 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3231892257 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -