BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10a08f (627 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 23 2.4 AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 22 5.6 AB095514-1|BAC76336.1| 72|Apis mellifera ecdyson receptor prot... 21 9.8 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 23.0 bits (47), Expect = 2.4 Identities = 16/50 (32%), Positives = 22/50 (44%), Gaps = 1/50 (2%) Frame = +1 Query: 382 YQKNVAKRCSTTNFWPKKSKSEYHCFSPI*LKVNRNL-AKTGPMRQRFQN 528 Y++ + CSTT P KS + H + +N NL A G F N Sbjct: 581 YKRRPQRACSTTGGVPSKSPTLTHSPTMYGDALNANLQAALGDSNMGFLN 630 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 21.8 bits (44), Expect = 5.6 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = -1 Query: 258 T*SSYGGKNLFSTVAVTAHQQHCNLYIITLKYAAHNKDC 142 T +SY NL ++ + ++CN +T+K NK C Sbjct: 73 TITSYHRINLKCSLVEFSENKNCNAGSLTVKKNFANKYC 111 >AB095514-1|BAC76336.1| 72|Apis mellifera ecdyson receptor protein. Length = 72 Score = 21.0 bits (42), Expect = 9.8 Identities = 9/31 (29%), Positives = 14/31 (45%) Frame = +1 Query: 364 LFYRLSYQKNVAKRCSTTNFWPKKSKSEYHC 456 ++ R Q+ K+C T P+ EY C Sbjct: 30 MYMRRKCQECRLKKCLTVGMRPECMVPEYQC 60 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 170,125 Number of Sequences: 438 Number of extensions: 3541 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18704709 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -