BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10a07f (668 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12544| Best HMM Match : DUF1218 (HMM E-Value=2.7) 27 0.53 SB_26361| Best HMM Match : fn3 (HMM E-Value=0) 30 2.0 SB_18417| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_13504| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_47160| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_30275| Best HMM Match : EGF_CA (HMM E-Value=1.3e-13) 28 7.9 SB_26886| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 >SB_12544| Best HMM Match : DUF1218 (HMM E-Value=2.7) Length = 290 Score = 27.1 bits (57), Expect(2) = 0.53 Identities = 9/28 (32%), Positives = 18/28 (64%) Frame = +3 Query: 243 VNNLIIDKRRNTMEYCYKLWVGNGQDIV 326 +++L++ +++ YC+ NGQDIV Sbjct: 130 IHDLLLSLQKHLFAYCHNATSNNGQDIV 157 Score = 23.4 bits (48), Expect(2) = 0.53 Identities = 14/51 (27%), Positives = 22/51 (43%) Frame = +3 Query: 324 VKKYFPLSFRLIMAGNYVKLIYRNYNLALKLGSTTNPSNERIAYGDGVDKH 476 ++ YF L+M+G L+ + +L L S R+ G G D H Sbjct: 183 IRYYFACFQELLMSGPANSLLQSHLSLFLPCAGEILGSVYRLLVGHGSDTH 233 >SB_26361| Best HMM Match : fn3 (HMM E-Value=0) Length = 1898 Score = 29.9 bits (64), Expect = 2.0 Identities = 27/74 (36%), Positives = 34/74 (45%), Gaps = 5/74 (6%) Frame = +3 Query: 408 LKLGSTTNPSNERIAYGDGVDKHTELVSWKFITLWENNRVYFKAHNTKYNQYLKMS---- 575 L+ GST S++ IA +T L S F R Y AH T Y YL +S Sbjct: 868 LESGSTLLASDDGIAPNKRTKVYTSLSSDVFY------RFYVYAHTT-YTTYLCLSVNAP 920 Query: 576 -TSTCNCNARDRVV 614 T C N+RDRV+ Sbjct: 921 CTQACRLNSRDRVL 934 >SB_18417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 441 Score = 29.5 bits (63), Expect = 2.6 Identities = 14/54 (25%), Positives = 21/54 (38%) Frame = -3 Query: 309 CRPTACSSTPWCSVSCQ*SDC*LHFERCCPGLGSRIPSSYVQHCRSHR*GCCCT 148 C+ CS++ C SC C L+ + + V C+S G CT Sbjct: 224 CQQVVCSASGKCDQSCDGEGCNLYCSEGAKTCNQKCQGACVTDCKSRWCGVTCT 277 >SB_13504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4924 Score = 28.3 bits (60), Expect = 6.0 Identities = 12/24 (50%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 171 HR*GCCCTVCPRGL--G*KGSCCP 106 H+ G C VCPRG+ KG C P Sbjct: 4552 HKNGFLCVVCPRGMYGNSKGECSP 4575 >SB_47160| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1806 Score = 28.3 bits (60), Expect = 6.0 Identities = 22/72 (30%), Positives = 32/72 (44%), Gaps = 2/72 (2%) Frame = +3 Query: 333 YFPLSFRLIMAGN--YVKLIYRNYNLALKLGSTTNPSNERIAYGDGVDKHTELVSWKFIT 506 YFP RLI + NY LA+ LG + + S + G+ VD+ W F Sbjct: 1387 YFPHMARLIDGQKPWCMSSSSSNYWLAIDLGVSVDVSAVEVK-GNDVDEDINQWIWDFSV 1445 Query: 507 LWENNRVYFKAH 542 + N+ V +K H Sbjct: 1446 EYSNDYVQWKQH 1457 >SB_30275| Best HMM Match : EGF_CA (HMM E-Value=1.3e-13) Length = 142 Score = 27.9 bits (59), Expect = 7.9 Identities = 14/43 (32%), Positives = 19/43 (44%) Frame = -1 Query: 164 EDAVVQFVLEVLVRRAHAVRG*FHDAGAGSEHAHCEHNEKFHF 36 ED V + +R+ +R F DA +E CE N HF Sbjct: 9 EDYTVNHSAAMAIRQCRCLRWLFQDAELKAEGLQCELNSDTHF 51 >SB_26886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6489 Score = 27.9 bits (59), Expect = 7.9 Identities = 23/79 (29%), Positives = 36/79 (45%), Gaps = 2/79 (2%) Frame = +1 Query: 109 TA*ALLTKTSRTNCTTASSPVTTTVLYVRAWNTRAKARAASFKM*LTI*SLTRD--GTPW 282 TA A+ T+ TTA TTT V A T A A++ + T ++ TP Sbjct: 1206 TAAAVTASTASVVTTTAEKATTTTAAMVEATTTEAAVTASTASVVTTTATIASSTITTPS 1265 Query: 283 STATSCGSATDRILSKSTS 339 +A S +A+ +S +T+ Sbjct: 1266 LSAISTTTASSVQVSAATN 1284 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,659,638 Number of Sequences: 59808 Number of extensions: 399005 Number of successful extensions: 1391 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1254 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1391 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1729817375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -