BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10a06f (513 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_02_0338 + 7426999-7428322,7428390-7428646 28 5.1 05_04_0118 - 18162934-18162982,18163246-18163357,18163583-18163622 28 5.1 05_03_0618 - 16262826-16263097,16263111-16263183 27 6.7 12_01_0357 + 2720860-2721066,2721169-2721384,2721481-2723608,272... 27 8.8 09_04_0269 + 16265191-16265472,16265574-16266149 27 8.8 >09_02_0338 + 7426999-7428322,7428390-7428646 Length = 526 Score = 27.9 bits (59), Expect = 5.1 Identities = 17/47 (36%), Positives = 20/47 (42%) Frame = -1 Query: 258 LMESTDPQCHILQHRRPRLPLMQLEAPCSFNFCSLRAIRRYKSYYVD 118 LM C L HR P L + L A L+AI KSYY + Sbjct: 397 LMVQHTRNCVTLPHRNPMLVVALLAATLGLVCLLLQAIYTMKSYYCE 443 >05_04_0118 - 18162934-18162982,18163246-18163357,18163583-18163622 Length = 66 Score = 27.9 bits (59), Expect = 5.1 Identities = 13/42 (30%), Positives = 19/42 (45%), Gaps = 6/42 (14%) Frame = +2 Query: 272 RFQLSGNSGRKHSRCCTSILRKFSGR------QHCVTVDCCC 379 R +G+K RCC S R+ + R + C+ CCC Sbjct: 17 RLDSEQQAGKKKGRCCGSSCRRSTKRGETSFIEGCIAALCCC 58 >05_03_0618 - 16262826-16263097,16263111-16263183 Length = 114 Score = 27.5 bits (58), Expect = 6.7 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +2 Query: 143 RIARREQKLKEHGASSCISGKRGRRC 220 R+ARR + LK + C G R RRC Sbjct: 11 RMARRRRWLKRRRSGHCRCGLRSRRC 36 >12_01_0357 + 2720860-2721066,2721169-2721384,2721481-2723608, 2723699-2724124,2724242-2724546,2724660-2724823, 2724899-2724980 Length = 1175 Score = 27.1 bits (57), Expect = 8.8 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +2 Query: 260 GSRARFQLSGNSGRKHSRCCTS 325 GSRA F+ NS +KHS+ C + Sbjct: 865 GSRALFEGGFNSSQKHSKSCAA 886 >09_04_0269 + 16265191-16265472,16265574-16266149 Length = 285 Score = 27.1 bits (57), Expect = 8.8 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = -1 Query: 255 MESTDPQCHILQHRRPRLPL 196 M T P C +L++ RPRLPL Sbjct: 157 MARTGPLCLLLENPRPRLPL 176 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,267,492 Number of Sequences: 37544 Number of extensions: 236029 Number of successful extensions: 510 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 505 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 510 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1106928780 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -