BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10a03f (637 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_34374| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_54470| Best HMM Match : E7 (HMM E-Value=1.5) 28 7.3 SB_47643| Best HMM Match : Peptidase_C48 (HMM E-Value=1.5e-05) 28 7.3 SB_38073| Best HMM Match : ABC_tran (HMM E-Value=1.2e-17) 28 7.3 SB_19883| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.3 >SB_34374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 306 Score = 32.7 bits (71), Expect = 0.26 Identities = 25/96 (26%), Positives = 42/96 (43%), Gaps = 3/96 (3%) Frame = +3 Query: 327 TLPLKEVFPGGLPNRFSVEGTFNARGQRRPWSLLRARSNNVLFSLILMPEPRKVAVLVQG 506 ++P +FP G+P FS+ T +L + N SL L P ++ + Sbjct: 20 SVPTGTLFPYGIPESFSIMATVRTEIDNSG-NLFSVYNANGELSLSLSVNPVELQYRTRS 78 Query: 507 ---SRAVFKSPELFTTGWHKLHVAVANRSVHIAVDC 605 SR F++ L WH++ ++VA V + DC Sbjct: 79 GGVSRIQFQA-SLADGEWHRIAISVARDQVKLLSDC 113 >SB_54470| Best HMM Match : E7 (HMM E-Value=1.5) Length = 216 Score = 27.9 bits (59), Expect = 7.3 Identities = 32/112 (28%), Positives = 46/112 (41%) Frame = +3 Query: 183 PNSKDSDFQTVALIAVYRLDRSDTTGVTLVQGSQDLQMAYRIGGGANLTLPLKEVFPGGL 362 PN ++ TV D+ D T S D + +I TL L E G Sbjct: 92 PNLDETPQHTVYCGMTLLFDQDDMTQEEDETNSDDKEPDLQIVVTKETTLTLAEAALHGE 151 Query: 363 PNRFSVEGTFNARGQRRPWSLLRARSNNVLFSLILMPEPRKVAVLVQGSRAV 518 R V+ +G SLL AR+N++L+SL L + ++ VL AV Sbjct: 152 RLRKFVQD----KGHEE-LSLLFARANDILYSLQLAGQKKQTMVLYSTPNAV 198 >SB_47643| Best HMM Match : Peptidase_C48 (HMM E-Value=1.5e-05) Length = 504 Score = 27.9 bits (59), Expect = 7.3 Identities = 32/112 (28%), Positives = 46/112 (41%) Frame = +3 Query: 183 PNSKDSDFQTVALIAVYRLDRSDTTGVTLVQGSQDLQMAYRIGGGANLTLPLKEVFPGGL 362 PN ++ TV D+ D T S D + +I TL L E G Sbjct: 380 PNLDETPQHTVYCGMTLLFDQDDMTQEEDETNSDDKEPDLQIVVTKETTLTLAEAALHGE 439 Query: 363 PNRFSVEGTFNARGQRRPWSLLRARSNNVLFSLILMPEPRKVAVLVQGSRAV 518 R V+ +G SLL AR+N++L+SL L + ++ VL AV Sbjct: 440 RLRKFVQD----KGHEE-LSLLFARANDILYSLQLAGQKKQTMVLYSTPNAV 486 >SB_38073| Best HMM Match : ABC_tran (HMM E-Value=1.2e-17) Length = 398 Score = 27.9 bits (59), Expect = 7.3 Identities = 28/95 (29%), Positives = 43/95 (45%), Gaps = 4/95 (4%) Frame = +3 Query: 348 FPGGLPNRFSVEGTFNARGQRRPWSLLRA--RSNNVL-FSLILMPEPRKVAVLVQGS-RA 515 FP GL + + G + GQR+ L RA R N +L ++ VL+Q + R+ Sbjct: 254 FPDGLDTKVTESGNNFSVGQRQLICLARALLRRNVILIIDEATAHVDQRTDVLIQKTIRS 313 Query: 516 VFKSPELFTTGWHKLHVAVANRSVHIAVDCVELNP 620 FK + T H+L+ + V + C LNP Sbjct: 314 KFKDCTVLTIA-HRLNTIMDMDRVMLLNPCTCLNP 347 >SB_19883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 656 Score = 27.9 bits (59), Expect = 7.3 Identities = 24/78 (30%), Positives = 31/78 (39%), Gaps = 3/78 (3%) Frame = -1 Query: 586 TDRFATATC--SLCHPVVNNSGLLNTALEPWTRTATFLGSGIKMRENS-TLFERARRRLH 416 TD +T TC + V G NTA PW F+ S + R+ + L ER RR + Sbjct: 281 TDARSTLTCRFQIFWLVARTMGYTNTAFNPWI-YFLFVSSTAQNRQRTMELIERGRRFIS 339 Query: 415 GLRCPRALKVPSTLNRFG 362 L NR G Sbjct: 340 TLSVSTRNPAARRNNRVG 357 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,434,474 Number of Sequences: 59808 Number of extensions: 423255 Number of successful extensions: 1520 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1461 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1519 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1596754500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -