BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10a02r (751 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1778.02 |rap1||telomere binding protein Rap1|Schizosaccharom... 29 0.71 SPAC17C9.03 |tif471||translation initiation factor eIF4G |Schizo... 27 3.8 SPBC1271.10c |||membrane transporter|Schizosaccharomyces pombe|c... 26 5.0 SPAC26A3.15c |nsp1||nucleoporin Nsp1|Schizosaccharomyces pombe|c... 26 5.0 SPAC1751.01c |gti1||gluconate transporter inducer Gti1|Schizosac... 25 8.7 SPAC1805.02c |||electron transfer flavoprotein beta subunit |Sch... 25 8.7 SPAC1002.14 |itt1||ubiquitin-protein ligase E3 |Schizosaccharomy... 25 8.7 SPBC30B4.05 |kap109||karyopherin Kap109|Schizosaccharomyces pomb... 25 8.7 >SPBC1778.02 |rap1||telomere binding protein Rap1|Schizosaccharomyces pombe|chr 2|||Manual Length = 693 Score = 29.1 bits (62), Expect = 0.71 Identities = 27/112 (24%), Positives = 49/112 (43%), Gaps = 9/112 (8%) Frame = +3 Query: 198 NGAIQREAKRLIVKNKR-------FERSQVLAFVVEWIDENKELEWESTFSTSRQHESFR 356 + ++ + + +V NKR F + + ++ V+++DE+ L + Q R Sbjct: 218 SASVSKSENKALVNNKRYSDSYFYFSKMRRISIDVDYVDEDLNL----INAYLSQFGKKR 273 Query: 357 HVTELFRHIKRYFSFVEHLHNFSHWHGVFFKYDKFIRI--ADNLVLTSGEFS 506 + EL + R FS + H FS W +F + FI D +L+ E S Sbjct: 274 SLNELCALLSRRFS---NRHTFSEWRALFMHFFPFINSEGVDPAILSDRETS 322 >SPAC17C9.03 |tif471||translation initiation factor eIF4G |Schizosaccharomyces pombe|chr 1|||Manual Length = 1403 Score = 26.6 bits (56), Expect = 3.8 Identities = 24/74 (32%), Positives = 31/74 (41%), Gaps = 1/74 (1%) Frame = +1 Query: 124 GNRSPSW*MKISLKYMLG-TLNNASTTGRSRGKPRGLLSRTKDSKGAKSLPLLSNG*TKT 300 GN PS+ K S Y G NN+ G PR SR + +SNG + Sbjct: 308 GNSHPSY-NKYS-HYQHGFNYNNSGNNRNESGHPRFRNSRRNYNNQGAYPTYMSNGRSAN 365 Query: 301 KSWNGNPPSVPLGS 342 +S NP +V GS Sbjct: 366 QSPRNNPQNVNNGS 379 >SPBC1271.10c |||membrane transporter|Schizosaccharomyces pombe|chr 2|||Manual Length = 581 Score = 26.2 bits (55), Expect = 5.0 Identities = 13/46 (28%), Positives = 21/46 (45%), Gaps = 4/46 (8%) Frame = -3 Query: 602 VKIFLAPKYDDNGIPLTLEDNWMKFF----ELDWFTTKLTAGQNKI 477 ++IFL P +G+ +D W+ F+ E DW G N + Sbjct: 338 LRIFLFPAVLYSGLQWGAQDAWLSFYLTTEEEDWMEAPYNYGDNAV 383 >SPAC26A3.15c |nsp1||nucleoporin Nsp1|Schizosaccharomyces pombe|chr 1|||Manual Length = 598 Score = 26.2 bits (55), Expect = 5.0 Identities = 20/70 (28%), Positives = 27/70 (38%) Frame = +1 Query: 187 NASTTGRSRGKPRGLLSRTKDSKGAKSLPLLSNG*TKTKSWNGNPPSVPLGSMSLLGM*Q 366 +A TTG S GKP G + T KG + G + K + P S Sbjct: 264 SAPTTGFSFGKPAGQAASTATDKGTTTTSSAGTGFSFGKPATTEDTNKPTAPNSAFTKPA 323 Query: 367 NSSDISKGTF 396 S+ +K TF Sbjct: 324 TSTGDNKPTF 333 >SPAC1751.01c |gti1||gluconate transporter inducer Gti1|Schizosaccharomyces pombe|chr 1|||Manual Length = 720 Score = 25.4 bits (53), Expect = 8.7 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = -3 Query: 656 SPFNVNIEVDSNVASDAVVKIFLAPKYDDNGIP 558 S F V++ VD +VAS + AP DN P Sbjct: 113 SAFTVSVPVDVDVASHVNISSPSAPSLSDNLFP 145 >SPAC1805.02c |||electron transfer flavoprotein beta subunit |Schizosaccharomyces pombe|chr 1|||Manual Length = 254 Score = 25.4 bits (53), Expect = 8.7 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = +3 Query: 465 RIADNLVLTSGEFSCEPV 518 RI D LV+T+G+ S EP+ Sbjct: 59 RIEDTLVVTAGQTSSEPI 76 >SPAC1002.14 |itt1||ubiquitin-protein ligase E3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 435 Score = 25.4 bits (53), Expect = 8.7 Identities = 16/44 (36%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = +3 Query: 12 FLHFLWILRMQNSSVYLNLI-FWNNIRLCVIRRNIEFVREPFTL 140 FL W+ Q + +LI WN I CV+ IE VR T+ Sbjct: 91 FLKSSWLPLKQKRVLTSSLIKLWNEIHDCVLFDAIEHVRSIATI 134 >SPBC30B4.05 |kap109||karyopherin Kap109|Schizosaccharomyces pombe|chr 2|||Manual Length = 967 Score = 25.4 bits (53), Expect = 8.7 Identities = 9/31 (29%), Positives = 19/31 (61%) Frame = +3 Query: 558 RYSVVIVFGSQEDFDNSVTGDIRINLNVNVE 650 R ++V+V G + FD +T + ++N N++ Sbjct: 375 RSAIVLVRGLLDHFDQKITSVVSTHINANLQ 405 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,146,824 Number of Sequences: 5004 Number of extensions: 69464 Number of successful extensions: 186 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 179 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 186 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 357280532 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -