SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fmgV1h08r
         (914 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF388659-3|AAK71993.1|  548|Apis mellifera 1D-myo-inositol-trisp...    25   0.96 
AF000632-1|AAC61894.1|  452|Apis mellifera major royal jelly pro...    23   2.9  
DQ026036-1|AAY87895.1|  529|Apis mellifera nicotinic acetylcholi...    22   6.8  
DQ026035-1|AAY87894.1|  529|Apis mellifera nicotinic acetylcholi...    22   6.8  

>AF388659-3|AAK71993.1|  548|Apis mellifera
           1D-myo-inositol-trisphosphate 3-kinaseisoform C protein.
          Length = 548

 Score = 25.0 bits (52), Expect = 0.96
 Identities = 9/34 (26%), Positives = 19/34 (55%)
 Frame = -3

Query: 609 CLGHKEFVKNIEILPNNYNYLISTSGDGTVKLWD 508
           C G++++++ +E+   N  +   +SGD     WD
Sbjct: 168 CTGYQQYLRLLEVPQINLEWGEGSSGDDLSSEWD 201


>AF000632-1|AAC61894.1|  452|Apis mellifera major royal jelly
           protein MRJP2 protein.
          Length = 452

 Score = 23.4 bits (48), Expect = 2.9
 Identities = 14/53 (26%), Positives = 27/53 (50%), Gaps = 1/53 (1%)
 Frame = -3

Query: 387 IVAFAVTKVNKHVTLIAIALHGLNIVFIYNLNLDDFHGF-SHKLEYKLKVEKL 232
           +V+ AV  ++   TL+ +A H  + + +Y    D FH   S+  +Y  +  K+
Sbjct: 186 LVSLAVQAIDLANTLVYMADHKGDALIVYQNADDSFHRLTSNTFDYDPRYAKM 238


>DQ026036-1|AAY87895.1|  529|Apis mellifera nicotinic acetylcholine
           receptor alpha6subunit protein.
          Length = 529

 Score = 22.2 bits (45), Expect = 6.8
 Identities = 8/12 (66%), Positives = 11/12 (91%)
 Frame = +3

Query: 426 VL*ILLLNFHHQ 461
           VL +L+LNFHH+
Sbjct: 341 VLTVLVLNFHHR 352


>DQ026035-1|AAY87894.1|  529|Apis mellifera nicotinic acetylcholine
           receptor alpha6subunit protein.
          Length = 529

 Score = 22.2 bits (45), Expect = 6.8
 Identities = 8/12 (66%), Positives = 11/12 (91%)
 Frame = +3

Query: 426 VL*ILLLNFHHQ 461
           VL +L+LNFHH+
Sbjct: 341 VLTVLVLNFHHR 352


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 230,816
Number of Sequences: 438
Number of extensions: 4856
Number of successful extensions: 29
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 27
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 29
length of database: 146,343
effective HSP length: 58
effective length of database: 120,939
effective search space used: 29750994
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -