SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fmgV19i08f
         (674 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ968562-1|CAI91546.1|  998|Apis mellifera protein ( Apis mellif...    27   0.12 
AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.             22   4.7  
DQ026039-1|AAY87898.1|  427|Apis mellifera nicotinic acetylcholi...    21   8.1  

>AJ968562-1|CAI91546.1|  998|Apis mellifera protein ( Apis mellifera
           ORF for hypotheticalprotein. ).
          Length = 998

 Score = 27.5 bits (58), Expect = 0.12
 Identities = 12/32 (37%), Positives = 19/32 (59%)
 Frame = +1

Query: 445 IAGRDFVGEVERAGVGAKLKRGERIWGVIPPH 540
           + GR+ V + ERA    K + G  I+ ++PPH
Sbjct: 734 LRGREVVAQRERAA-DMKRRNGALIYNILPPH 764


>AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.
          Length = 1598

 Score = 22.2 bits (45), Expect = 4.7
 Identities = 6/12 (50%), Positives = 8/12 (66%)
 Frame = -2

Query: 673 PPAPRWRPSDRC 638
           PP   W+P D+C
Sbjct: 416 PPPEDWKPLDKC 427


>DQ026039-1|AAY87898.1|  427|Apis mellifera nicotinic acetylcholine
           receptor beta2subunit protein.
          Length = 427

 Score = 21.4 bits (43), Expect = 8.1
 Identities = 6/10 (60%), Positives = 10/10 (100%)
 Frame = +2

Query: 200 HLMLKLVWDE 229
           H+MLKL+W++
Sbjct: 83  HVMLKLMWEQ 92


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 186,186
Number of Sequences: 438
Number of extensions: 4223
Number of successful extensions: 7
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 20464920
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -