SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fmgV19g14r
         (734 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY395073-1|AAQ96729.1|  203|Apis mellifera GABA neurotransmitter...    23   2.3  
S78458-1|AAB34402.1|   46|Apis mellifera apamin protein.               22   6.9  
DQ325083-1|ABD14097.1|  189|Apis mellifera complementary sex det...    21   9.1  

>AY395073-1|AAQ96729.1|  203|Apis mellifera GABA neurotransmitter
           transporter-1A protein.
          Length = 203

 Score = 23.4 bits (48), Expect = 2.3
 Identities = 10/31 (32%), Positives = 16/31 (51%)
 Frame = +3

Query: 300 CWMITIQDTYFVTSISIPDMNTTIC*TTEDV 392
           CW+   +   F+   S+ D+N TI   T+ V
Sbjct: 121 CWLQMTKHHNFIKVCSVNDVNMTITELTDPV 151


>S78458-1|AAB34402.1|   46|Apis mellifera apamin protein.
          Length = 46

 Score = 21.8 bits (44), Expect = 6.9
 Identities = 8/17 (47%), Positives = 9/17 (52%)
 Frame = +3

Query: 216 NCG*PECHICTC*CQHH 266
           NC  PE  +C   CQ H
Sbjct: 29  NCKAPETALCARRCQQH 45


>DQ325083-1|ABD14097.1|  189|Apis mellifera complementary sex
           determiner protein.
          Length = 189

 Score = 21.4 bits (43), Expect = 9.1
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -3

Query: 528 NYVNKYQWVNNSF 490
           NY NKY + NN++
Sbjct: 99  NYNNKYNYNNNNY 111


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 203,884
Number of Sequences: 438
Number of extensions: 4981
Number of successful extensions: 7
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 22901220
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -