BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fmgV19f10f
(736 letters)
Database: tribolium
336 sequences; 122,585 total letters
Searching.......................................................done
Score E
Sequences producing significant alignments: (bits) Value
EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 prot... 23 2.6
>EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4
protein.
Length = 475
Score = 23.0 bits (47), Expect = 2.6
Identities = 13/39 (33%), Positives = 20/39 (51%)
Frame = +3
Query: 495 ETLGRIINVIGEPIDERGPIPTDKTAAIHAEAPEFVDMS 611
+TLG N I EP+ + T K ++ A AP D++
Sbjct: 380 QTLGGSSNEIVEPVPQPVEEVTQKPSSTKAPAPPSRDLT 418
Database: tribolium
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 122,585
Number of sequences in database: 336
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 181,776
Number of Sequences: 336
Number of extensions: 4268
Number of successful extensions: 4
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 19675845
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -