Bombyx BLAST Result against celegans

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fmgV19e01r
         (947 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z72508-5|CAA96638.1|  525|Caenorhabditis elegans Hypothetical pr...    29   3.7  

>Z72508-5|CAA96638.1|  525|Caenorhabditis elegans Hypothetical
           protein F28H7.6 protein.
          Length = 525

 Score = 29.5 bits (63), Expect = 3.7
 Identities = 18/61 (29%), Positives = 29/61 (47%), Gaps = 2/61 (3%)
 Frame = -2

Query: 412 ILNWITKIRLRLNHFDSDIALYSSITTLKIVGFALIHPVLRNVFEYKLVFKSNCL--RFI 239
           +L  + K++  L HFDS    YS  TT  ++G   +  +     E+   F+ N L   F+
Sbjct: 446 MLRQLRKVKAVLRHFDSKSDTYSEKTTYYLIGGCFVIAIF---MEFIWFFRKNLLLPNFL 502

Query: 238 Y 236
           Y
Sbjct: 503 Y 503


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,737,303
Number of Sequences: 27780
Number of extensions: 401951
Number of successful extensions: 795
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 762
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 795
length of database: 12,740,198
effective HSP length: 81
effective length of database: 10,490,018
effective search space used: 2454664212
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)