Bombyx BLAST Result against human

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fmgV19b22r
         (422 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BC036200-1|AAH36200.1|  263|Homo sapiens C1orf71 protein protein.      29   6.5  

>BC036200-1|AAH36200.1|  263|Homo sapiens C1orf71 protein protein.
          Length = 263

 Score = 29.1 bits (62), Expect = 6.5
 Identities = 11/43 (25%), Positives = 26/43 (60%)
 Frame = +2

Query: 29  ISRFYLQQIIHTLN*IE*RF*YTYHNVWNIEIGLLTRCNVYKV 157
           + R Y +Q++  L+ I+ ++   Y   WN+E+ ++ +  +YK+
Sbjct: 215 LERLYHEQLLANLSAIQEQW-GKYRPTWNVELAVIQQVTIYKI 256


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 50,341,377
Number of Sequences: 237096
Number of extensions: 798424
Number of successful extensions: 941
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 934
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 941
length of database: 76,859,062
effective HSP length: 83
effective length of database: 57,180,094
effective search space used: 3259265358
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)