BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fmgV19a06r
(914 letters)
Database: rice
37,544 sequences; 14,793,348 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
05_05_0163 + 22842955-22844371,22845519-22845592,22845913-22845948 31 0.97
>05_05_0163 + 22842955-22844371,22845519-22845592,22845913-22845948
Length = 508
Score = 31.5 bits (68), Expect = 0.97
Identities = 19/53 (35%), Positives = 28/53 (52%), Gaps = 3/53 (5%)
Frame = -2
Query: 688 LIFVIITSQILVIVASY---DEYGFW*PLHQVGFSTLGNLTGAAKLVPSVSKL 539
L +V ++ Q +V S+ DE G W HQV STLG G+ K +P + +
Sbjct: 357 LRYVEVSDQEPFVVMSFTLDDESGHWTLDHQVALSTLGAKGGSPKGIPYIGAI 409
Database: rice
Posted date: Oct 4, 2007 10:57 AM
Number of letters in database: 14,793,348
Number of sequences in database: 37,544
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 20,511,197
Number of Sequences: 37544
Number of extensions: 382665
Number of successful extensions: 510
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 501
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 510
length of database: 14,793,348
effective HSP length: 82
effective length of database: 11,714,740
effective search space used: 2600672280
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -