SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fmgV18p12r
         (886 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ968562-1|CAI91546.1|  998|Apis mellifera protein ( Apis mellif...    22   6.5  
AY569781-1|AAS75781.1|  461|Apis mellifera neuronal nicotinic ac...    22   8.6  
AF393493-1|AAL60418.1|  142|Apis mellifera odorant binding prote...    22   8.6  
AF166497-1|AAD51945.1|  142|Apis mellifera putative odorant-bind...    22   8.6  

>AJ968562-1|CAI91546.1|  998|Apis mellifera protein ( Apis mellifera
           ORF for hypotheticalprotein. ).
          Length = 998

 Score = 22.2 bits (45), Expect = 6.5
 Identities = 12/43 (27%), Positives = 17/43 (39%)
 Frame = -3

Query: 215 NGEFDYHMIKGLPREDYIYDEIASTSEFIRLRSPVYPEVANRI 87
           NGEF+     G  RE+ +      T   +R   P  P V   +
Sbjct: 419 NGEFEVEPAHGEDREEALQKAGIVTYFIVRALKPFIPAVTKSL 461


>AY569781-1|AAS75781.1|  461|Apis mellifera neuronal nicotinic
           acetylcholine Apisa7-2 subunit protein.
          Length = 461

 Score = 21.8 bits (44), Expect = 8.6
 Identities = 8/12 (66%), Positives = 10/12 (83%)
 Frame = +3

Query: 669 FAATRPVEYHSC 704
           F+A R VEY+SC
Sbjct: 184 FSARRNVEYYSC 195


>AF393493-1|AAL60418.1|  142|Apis mellifera odorant binding protein
           ASP2 protein.
          Length = 142

 Score = 21.8 bits (44), Expect = 8.6
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = -3

Query: 665 ECNIGNLITD 636
           ECNIGN  TD
Sbjct: 125 ECNIGNKYTD 134


>AF166497-1|AAD51945.1|  142|Apis mellifera putative odorant-binding
           protein ASP2 protein.
          Length = 142

 Score = 21.8 bits (44), Expect = 8.6
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = -3

Query: 665 ECNIGNLITD 636
           ECNIGN  TD
Sbjct: 125 ECNIGNKYTD 134


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 236,127
Number of Sequences: 438
Number of extensions: 4794
Number of successful extensions: 7
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 28766349
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -