BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fmgV18p12r
(886 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 22 6.5
AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic ac... 22 8.6
AF393493-1|AAL60418.1| 142|Apis mellifera odorant binding prote... 22 8.6
AF166497-1|AAD51945.1| 142|Apis mellifera putative odorant-bind... 22 8.6
>AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera
ORF for hypotheticalprotein. ).
Length = 998
Score = 22.2 bits (45), Expect = 6.5
Identities = 12/43 (27%), Positives = 17/43 (39%)
Frame = -3
Query: 215 NGEFDYHMIKGLPREDYIYDEIASTSEFIRLRSPVYPEVANRI 87
NGEF+ G RE+ + T +R P P V +
Sbjct: 419 NGEFEVEPAHGEDREEALQKAGIVTYFIVRALKPFIPAVTKSL 461
>AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic
acetylcholine Apisa7-2 subunit protein.
Length = 461
Score = 21.8 bits (44), Expect = 8.6
Identities = 8/12 (66%), Positives = 10/12 (83%)
Frame = +3
Query: 669 FAATRPVEYHSC 704
F+A R VEY+SC
Sbjct: 184 FSARRNVEYYSC 195
>AF393493-1|AAL60418.1| 142|Apis mellifera odorant binding protein
ASP2 protein.
Length = 142
Score = 21.8 bits (44), Expect = 8.6
Identities = 8/10 (80%), Positives = 8/10 (80%)
Frame = -3
Query: 665 ECNIGNLITD 636
ECNIGN TD
Sbjct: 125 ECNIGNKYTD 134
>AF166497-1|AAD51945.1| 142|Apis mellifera putative odorant-binding
protein ASP2 protein.
Length = 142
Score = 21.8 bits (44), Expect = 8.6
Identities = 8/10 (80%), Positives = 8/10 (80%)
Frame = -3
Query: 665 ECNIGNLITD 636
ECNIGN TD
Sbjct: 125 ECNIGNKYTD 134
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 236,127
Number of Sequences: 438
Number of extensions: 4794
Number of successful extensions: 7
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 28766349
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -