SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fmgV18p03r
         (845 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF000632-1|AAC61894.1|  452|Apis mellifera major royal jelly pro...    23   2.7  
DQ288392-1|ABC41342.1|  120|Apis mellifera nanos protein.              22   6.2  
D79208-1|BAA11466.1|  567|Apis mellifera alpha-glucosidase protein.    22   8.2  
AB253417-1|BAE86928.1|  567|Apis mellifera alpha-glucosidase pro...    22   8.2  

>AF000632-1|AAC61894.1|  452|Apis mellifera major royal jelly
           protein MRJP2 protein.
          Length = 452

 Score = 23.4 bits (48), Expect = 2.7
 Identities = 13/51 (25%), Positives = 26/51 (50%)
 Frame = -3

Query: 762 SNQKMKVKLYMDKEQNCFKGDALCTYIKIESVDLALKLLDGSDCKGNTIKV 610
           SN   ++++  D   N   G      + ++++DLA  L+  +D KG+ + V
Sbjct: 163 SNHLKQIEIPHDIAVNATTGKGGLVSLAVQAIDLANTLVYMADHKGDALIV 213


>DQ288392-1|ABC41342.1|  120|Apis mellifera nanos protein.
          Length = 120

 Score = 22.2 bits (45), Expect = 6.2
 Identities = 7/13 (53%), Positives = 8/13 (61%)
 Frame = -3

Query: 363 CGKCGDVRKVVLY 325
           CG CGD+   V Y
Sbjct: 78  CGACGDIAHTVKY 90


>D79208-1|BAA11466.1|  567|Apis mellifera alpha-glucosidase protein.
          Length = 567

 Score = 21.8 bits (44), Expect = 8.2
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = +1

Query: 199 AIPYLCSDLSF 231
           A+PY+C D+ F
Sbjct: 224 ALPYICEDMRF 234


>AB253417-1|BAE86928.1|  567|Apis mellifera alpha-glucosidase
           protein.
          Length = 567

 Score = 21.8 bits (44), Expect = 8.2
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = +1

Query: 199 AIPYLCSDLSF 231
           A+PY+C D+ F
Sbjct: 224 ALPYICEDMRF 234


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 205,604
Number of Sequences: 438
Number of extensions: 4015
Number of successful extensions: 14
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 14
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 14
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 27188448
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -