Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fmgV18a14f
         (771 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF274024-1|AAF90150.1|  232|Apis mellifera tetraspanin F139 prot...    22   7.3  
AB270697-1|BAF75928.1|  735|Apis mellifera FoxP protein protein.       22   7.3  

>AF274024-1|AAF90150.1|  232|Apis mellifera tetraspanin F139
           protein.
          Length = 232

 Score = 21.8 bits (44), Expect = 7.3
 Identities = 6/13 (46%), Positives = 8/13 (61%)
 Frame = +1

Query: 679 SACCGGPAGETCS 717
           ++CC  P   TCS
Sbjct: 161 ASCCNSPENNTCS 173


>AB270697-1|BAF75928.1|  735|Apis mellifera FoxP protein protein.
          Length = 735

 Score = 21.8 bits (44), Expect = 7.3
 Identities = 10/35 (28%), Positives = 14/35 (40%)
 Frame = -2

Query: 692 PQHALERRYSLPQNHARDETQLERLPSRHEALLPQ 588
           P   + +   L Q H    TQL+    +H   L Q
Sbjct: 67  PASGIHQMQQLLQQHILSPTQLQSFMQQHSLYLQQ 101


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 183,508
Number of Sequences: 438
Number of extensions: 3601
Number of successful extensions: 14
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 14
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 14
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 24154023
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)