SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fmgV16l16f
         (690 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ026039-1|AAY87898.1|  427|Apis mellifera nicotinic acetylcholi...    23   2.1  
AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso...    21   8.4  

>DQ026039-1|AAY87898.1|  427|Apis mellifera nicotinic acetylcholine
           receptor beta2subunit protein.
          Length = 427

 Score = 23.4 bits (48), Expect = 2.1
 Identities = 18/59 (30%), Positives = 24/59 (40%), Gaps = 3/59 (5%)
 Frame = +3

Query: 468 SYNDWMPSTSTRLWSLCSVA*TLMVDSVPNL---DRKAMLV*FTAVWVHCRYASAWMPY 635
           SY  W+P     + S+ SV   L + SV  +       + V FT     C Y   W PY
Sbjct: 112 SYEIWVPDIV--MHSVTSVGIDLEMPSVECIVFNSGTILCVPFTTYTPVCEYDHTWWPY 168


>AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor
            protein.
          Length = 1770

 Score = 21.4 bits (43), Expect = 8.4
 Identities = 6/10 (60%), Positives = 9/10 (90%)
 Frame = +2

Query: 50   YYHPVSKHCS 79
            Y+H V+KHC+
Sbjct: 1679 YHHNVNKHCT 1688


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 193,079
Number of Sequences: 438
Number of extensions: 4219
Number of successful extensions: 7
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 21073995
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -