BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fmgV16l16f
(690 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholi... 23 2.1
AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 21 8.4
>DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholine
receptor beta2subunit protein.
Length = 427
Score = 23.4 bits (48), Expect = 2.1
Identities = 18/59 (30%), Positives = 24/59 (40%), Gaps = 3/59 (5%)
Frame = +3
Query: 468 SYNDWMPSTSTRLWSLCSVA*TLMVDSVPNL---DRKAMLV*FTAVWVHCRYASAWMPY 635
SY W+P + S+ SV L + SV + + V FT C Y W PY
Sbjct: 112 SYEIWVPDIV--MHSVTSVGIDLEMPSVECIVFNSGTILCVPFTTYTPVCEYDHTWWPY 168
>AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor
protein.
Length = 1770
Score = 21.4 bits (43), Expect = 8.4
Identities = 6/10 (60%), Positives = 9/10 (90%)
Frame = +2
Query: 50 YYHPVSKHCS 79
Y+H V+KHC+
Sbjct: 1679 YHHNVNKHCT 1688
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 193,079
Number of Sequences: 438
Number of extensions: 4219
Number of successful extensions: 7
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 21073995
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -