SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fmgV16a15f
         (763 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ013068-1|AAY81956.1|  931|Apis mellifera dusty protein kinase ...    23   4.1  
DQ013067-1|AAY81955.1|  969|Apis mellifera dusty protein kinase ...    23   4.1  
AY395072-1|AAQ96728.1|  593|Apis mellifera GABA neurotransmitter...    21   9.4  
AY395071-1|AAQ96727.1|  646|Apis mellifera GABA neurotransmitter...    21   9.4  

>DQ013068-1|AAY81956.1|  931|Apis mellifera dusty protein kinase
           isoform B protein.
          Length = 931

 Score = 22.6 bits (46), Expect = 4.1
 Identities = 20/54 (37%), Positives = 26/54 (48%)
 Frame = -3

Query: 239 SCLFRSVKYAGLLPQSSIYYMELLTLPQHQNLPPFFKSYSFCRTLSLIFRSLKL 78
           +CL  S     +L  S+ Y +EL     H + P  F  YSF   L+LIF S  L
Sbjct: 450 TCLLASDALKQIL--SAAYNVEL-----HNSSP--FSIYSFLERLNLIFMSSSL 494


>DQ013067-1|AAY81955.1|  969|Apis mellifera dusty protein kinase
           isoform A protein.
          Length = 969

 Score = 22.6 bits (46), Expect = 4.1
 Identities = 20/54 (37%), Positives = 26/54 (48%)
 Frame = -3

Query: 239 SCLFRSVKYAGLLPQSSIYYMELLTLPQHQNLPPFFKSYSFCRTLSLIFRSLKL 78
           +CL  S     +L  S+ Y +EL     H + P  F  YSF   L+LIF S  L
Sbjct: 488 TCLLASDALKQIL--SAAYNVEL-----HNSSP--FSIYSFLERLNLIFMSSSL 532


>AY395072-1|AAQ96728.1|  593|Apis mellifera GABA neurotransmitter
           transporter-1B protein.
          Length = 593

 Score = 21.4 bits (43), Expect = 9.4
 Identities = 6/8 (75%), Positives = 8/8 (100%)
 Frame = -2

Query: 219 EVCWTITT 196
           ++CWTITT
Sbjct: 492 KICWTITT 499


>AY395071-1|AAQ96727.1|  646|Apis mellifera GABA neurotransmitter
           transporter-1B protein.
          Length = 646

 Score = 21.4 bits (43), Expect = 9.4
 Identities = 6/8 (75%), Positives = 8/8 (100%)
 Frame = -2

Query: 219 EVCWTITT 196
           ++CWTITT
Sbjct: 545 KICWTITT 552


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 195,981
Number of Sequences: 438
Number of extensions: 3944
Number of successful extensions: 6
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 23789892
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -