SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fmgV14m20f
         (602 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC13E7.02 |cwf24||GCN5-related N acetyltransferase|Schizosacch...    25   8.5  
SPCC70.05c |||serine/threonine protein kinase |Schizosaccharomyc...    25   8.5  

>SPBC13E7.02 |cwf24||GCN5-related N
           acetyltransferase|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 533

 Score = 25.0 bits (52), Expect = 8.5
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = +3

Query: 546 ALACGHYFCNDC 581
           A  CGH+FC  C
Sbjct: 266 ATTCGHHFCEQC 277


>SPCC70.05c |||serine/threonine protein kinase |Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 781

 Score = 25.0 bits (52), Expect = 8.5
 Identities = 11/37 (29%), Positives = 20/37 (54%), Gaps = 4/37 (10%)
 Frame = -3

Query: 513 KQHNLICLIYFVKALVASPY*KPT----LHLHFLYIC 415
           +++NLIC +  ++     PY KP     +H+  L+ C
Sbjct: 685 REYNLICDVQNIRISKTLPYFKPVNDLPMHMQRLFFC 721


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,122,411
Number of Sequences: 5004
Number of extensions: 36002
Number of successful extensions: 101
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 100
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 101
length of database: 2,362,478
effective HSP length: 69
effective length of database: 2,017,202
effective search space used: 264253462
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -