SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fmgV13l14r
         (656 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM076717-1|CAJ28210.1|  501|Apis mellifera serotonin receptor pr...    23   3.4  
DQ325082-1|ABD14096.1|  179|Apis mellifera complementary sex det...    22   5.9  
AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat...    21   7.8  

>AM076717-1|CAJ28210.1|  501|Apis mellifera serotonin receptor
           protein.
          Length = 501

 Score = 22.6 bits (46), Expect = 3.4
 Identities = 9/36 (25%), Positives = 17/36 (47%)
 Frame = -3

Query: 108 PKHV*HALSILFQIHLIIGNCYYNFVFIVYVYHYAF 1
           P H     +  +QI+  +G+ Y     ++ VY+  F
Sbjct: 191 PSHCVVCQNFFYQIYATLGSFYIPLFVMIQVYYKIF 226


>DQ325082-1|ABD14096.1|  179|Apis mellifera complementary sex
           determiner protein.
          Length = 179

 Score = 21.8 bits (44), Expect = 5.9
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = +3

Query: 30  KQNYNNNC 53
           K NYNNNC
Sbjct: 97  KYNYNNNC 104


>AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate
           receptor protein.
          Length = 1040

 Score = 21.4 bits (43), Expect = 7.8
 Identities = 6/10 (60%), Positives = 8/10 (80%)
 Frame = +2

Query: 521 LHHYPTTHNN 550
           +HHYPT  +N
Sbjct: 795 MHHYPTREDN 804


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 178,438
Number of Sequences: 438
Number of extensions: 3873
Number of successful extensions: 7
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 19734030
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -