SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fmgV13f07r
         (785 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY769960-1|AAV34676.1|  603|Apis mellifera soluble guanylyl cycl...    22   5.6  
AB181489-1|BAD22772.1|  603|Apis mellifera soluble guanylyl cycl...    22   5.6  
AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr...    22   7.4  

>AY769960-1|AAV34676.1|  603|Apis mellifera soluble guanylyl cyclase
           beta 1 subunit protein.
          Length = 603

 Score = 22.2 bits (45), Expect = 5.6
 Identities = 6/12 (50%), Positives = 9/12 (75%)
 Frame = -3

Query: 108 IPEPCKCAIRLV 73
           +PEPC+C  R +
Sbjct: 475 LPEPCRCHARCI 486


>AB181489-1|BAD22772.1|  603|Apis mellifera soluble guanylyl cyclase
           beta 1 subunit protein.
          Length = 603

 Score = 22.2 bits (45), Expect = 5.6
 Identities = 6/12 (50%), Positives = 9/12 (75%)
 Frame = -3

Query: 108 IPEPCKCAIRLV 73
           +PEPC+C  R +
Sbjct: 475 LPEPCRCHARCI 486


>AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor
           protein.
          Length = 1370

 Score = 21.8 bits (44), Expect = 7.4
 Identities = 11/30 (36%), Positives = 14/30 (46%)
 Frame = +1

Query: 271 SFAGVFTLTVLNDGVNYLNRA*VFWFSDIF 360
           +F G+  L VLN   N L       F D+F
Sbjct: 330 TFLGLIRLIVLNLSYNMLTHIDARMFKDLF 359


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 181,264
Number of Sequences: 438
Number of extensions: 3242
Number of successful extensions: 7
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 24760908
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -