SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fmgV13d21r
         (756 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U66709-1|AAB07515.1|  182|Apis mellifera ankyrin protein.              23   4.1  
DQ869051-1|ABJ09598.1|  581|Apis mellifera pyrokinin-like recept...    22   7.1  
AY336529-1|AAQ02340.1|  712|Apis mellifera transferrin protein.        22   7.1  
AY336528-1|AAQ02339.1|  712|Apis mellifera transferrin protein.        22   7.1  
AY217097-1|AAO39761.1|  712|Apis mellifera transferrin protein.        22   7.1  

>U66709-1|AAB07515.1|  182|Apis mellifera ankyrin protein.
          Length = 182

 Score = 22.6 bits (46), Expect = 4.1
 Identities = 9/16 (56%), Positives = 12/16 (75%)
 Frame = +3

Query: 528 IIGIFVNVIPVITVEP 575
           ++G  V V PVIT+EP
Sbjct: 28  LLGNCVRVSPVITIEP 43


>DQ869051-1|ABJ09598.1|  581|Apis mellifera pyrokinin-like receptor
           2 protein.
          Length = 581

 Score = 21.8 bits (44), Expect = 7.1
 Identities = 12/30 (40%), Positives = 15/30 (50%)
 Frame = -3

Query: 412 YLNNLRNK*LCDIILNNF*LDLKLMYTNVC 323
           YL+   N  L +I+ N F    KLM  N C
Sbjct: 338 YLSTTVNPLLYNIMSNKFREAFKLMLPNCC 367


>AY336529-1|AAQ02340.1|  712|Apis mellifera transferrin protein.
          Length = 712

 Score = 21.8 bits (44), Expect = 7.1
 Identities = 6/13 (46%), Positives = 10/13 (76%)
 Frame = -1

Query: 459 YWDSYTGWSSSLY 421
           Y DS+ GW++ +Y
Sbjct: 500 YKDSFAGWTAPIY 512


>AY336528-1|AAQ02339.1|  712|Apis mellifera transferrin protein.
          Length = 712

 Score = 21.8 bits (44), Expect = 7.1
 Identities = 6/13 (46%), Positives = 10/13 (76%)
 Frame = -1

Query: 459 YWDSYTGWSSSLY 421
           Y DS+ GW++ +Y
Sbjct: 500 YKDSFAGWTAPIY 512


>AY217097-1|AAO39761.1|  712|Apis mellifera transferrin protein.
          Length = 712

 Score = 21.8 bits (44), Expect = 7.1
 Identities = 6/13 (46%), Positives = 10/13 (76%)
 Frame = -1

Query: 459 YWDSYTGWSSSLY 421
           Y DS+ GW++ +Y
Sbjct: 500 YKDSFAGWTAPIY 512


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 192,212
Number of Sequences: 438
Number of extensions: 4417
Number of successful extensions: 5
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 23753925
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -